Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2MFB2

Protein Details
Accession A0A1Y2MFB2    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
131-157SHETPTKTRRSEKRRSKTKRSDKEEVPBasic
NLS Segment(s)
PositionSequence
102-127RKGPTKTQGPGRRGEPAKEAAPTKRE
134-153TPTKTRRSEKRRSKTKRSDK
Subcellular Location(s) nucl 13, mito 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR000571  Znf_CCCH  
IPR036855  Znf_CCCH_sf  
Gene Ontology GO:0046872  F:metal ion binding  
PROSITE View protein in PROSITE  
PS50103  ZF_C3H1  
Amino Acid Sequences MRSDRWSMIGETDQTAVPLRVRPRPSDQQTDPGIVPFPKKRRFCRFWIEHGAYKFGERCCFLHEMPDREKLRLMGFTDHPEWHKIENPRLYELKPALVPGNRKGPTKTQGPGRRGEPAKEAAPTKRESYISHETPTKTRRSEKRRSKTKRSDKEEVPVKNEVLVRKEVSIEKDVPFKREKPTAKEEHISRGSPEPNIFTKKRRGAENNLVFRSGALRAPSHAPTISLIDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.18
4 0.16
5 0.19
6 0.23
7 0.29
8 0.33
9 0.38
10 0.45
11 0.54
12 0.59
13 0.63
14 0.62
15 0.62
16 0.61
17 0.59
18 0.51
19 0.41
20 0.38
21 0.3
22 0.32
23 0.32
24 0.39
25 0.44
26 0.52
27 0.6
28 0.68
29 0.72
30 0.73
31 0.76
32 0.74
33 0.73
34 0.75
35 0.71
36 0.66
37 0.62
38 0.58
39 0.47
40 0.42
41 0.38
42 0.29
43 0.27
44 0.24
45 0.23
46 0.24
47 0.27
48 0.25
49 0.3
50 0.33
51 0.36
52 0.37
53 0.46
54 0.43
55 0.4
56 0.42
57 0.34
58 0.3
59 0.28
60 0.26
61 0.21
62 0.22
63 0.25
64 0.26
65 0.27
66 0.26
67 0.25
68 0.24
69 0.21
70 0.26
71 0.26
72 0.31
73 0.34
74 0.35
75 0.37
76 0.37
77 0.36
78 0.35
79 0.31
80 0.26
81 0.21
82 0.2
83 0.19
84 0.19
85 0.21
86 0.19
87 0.28
88 0.28
89 0.29
90 0.3
91 0.32
92 0.34
93 0.36
94 0.36
95 0.36
96 0.42
97 0.44
98 0.45
99 0.41
100 0.45
101 0.42
102 0.4
103 0.33
104 0.29
105 0.27
106 0.26
107 0.26
108 0.21
109 0.23
110 0.23
111 0.22
112 0.22
113 0.22
114 0.21
115 0.27
116 0.32
117 0.31
118 0.31
119 0.33
120 0.31
121 0.36
122 0.39
123 0.36
124 0.33
125 0.39
126 0.47
127 0.52
128 0.62
129 0.68
130 0.74
131 0.8
132 0.85
133 0.88
134 0.9
135 0.92
136 0.91
137 0.89
138 0.86
139 0.79
140 0.79
141 0.76
142 0.68
143 0.61
144 0.53
145 0.45
146 0.4
147 0.39
148 0.32
149 0.27
150 0.27
151 0.23
152 0.21
153 0.24
154 0.23
155 0.24
156 0.25
157 0.25
158 0.24
159 0.31
160 0.32
161 0.33
162 0.36
163 0.35
164 0.37
165 0.44
166 0.48
167 0.47
168 0.55
169 0.59
170 0.6
171 0.64
172 0.6
173 0.61
174 0.59
175 0.52
176 0.46
177 0.44
178 0.4
179 0.36
180 0.35
181 0.3
182 0.32
183 0.39
184 0.4
185 0.4
186 0.48
187 0.53
188 0.56
189 0.61
190 0.62
191 0.64
192 0.72
193 0.76
194 0.76
195 0.69
196 0.65
197 0.55
198 0.48
199 0.41
200 0.32
201 0.25
202 0.18
203 0.17
204 0.19
205 0.24
206 0.26
207 0.27
208 0.25
209 0.23
210 0.22