Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2MF70

Protein Details
Accession A0A1Y2MF70    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
103-127GFLSRLRTKKGRKLLMRRLTKGRTNHydrophilic
NLS Segment(s)
PositionSequence
98-124RKRRHGFLSRLRTKKGRKLLMRRLTKG
Subcellular Location(s) nucl 11, mito 11, mito_nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MNALRCLRAVAVARPAALLEPSIAQQARNMSLLNARRPMLSASSMPSTLSALGTTPSAVTCSSETLDIMGKISASPAFAGVQIRCGPRDTYNPSHFVRKRRHGFLSRLRTKKGRKLLMRRLTKGRTNLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.2
4 0.17
5 0.14
6 0.08
7 0.08
8 0.09
9 0.13
10 0.13
11 0.12
12 0.14
13 0.16
14 0.17
15 0.17
16 0.17
17 0.14
18 0.2
19 0.25
20 0.27
21 0.28
22 0.26
23 0.25
24 0.26
25 0.27
26 0.23
27 0.2
28 0.17
29 0.16
30 0.17
31 0.17
32 0.16
33 0.15
34 0.13
35 0.11
36 0.1
37 0.07
38 0.06
39 0.06
40 0.06
41 0.06
42 0.05
43 0.05
44 0.05
45 0.05
46 0.06
47 0.06
48 0.07
49 0.07
50 0.07
51 0.07
52 0.07
53 0.08
54 0.07
55 0.07
56 0.06
57 0.05
58 0.05
59 0.06
60 0.05
61 0.05
62 0.05
63 0.05
64 0.05
65 0.06
66 0.09
67 0.08
68 0.11
69 0.14
70 0.15
71 0.15
72 0.17
73 0.18
74 0.18
75 0.26
76 0.3
77 0.36
78 0.38
79 0.42
80 0.43
81 0.51
82 0.53
83 0.54
84 0.57
85 0.59
86 0.63
87 0.65
88 0.72
89 0.69
90 0.74
91 0.76
92 0.77
93 0.77
94 0.74
95 0.73
96 0.74
97 0.75
98 0.75
99 0.75
100 0.74
101 0.74
102 0.79
103 0.85
104 0.86
105 0.87
106 0.85
107 0.84
108 0.81
109 0.79
110 0.76