Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2LU42

Protein Details
Accession A0A1Y2LU42    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
11-30QLKKAFKGMFGKKKAKKGEABasic
NLS Segment(s)
PositionSequence
16-28FKGMFGKKKAKKG
Subcellular Location(s) mito 16, nucl 7.5, cyto_nucl 6, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MPGVPPDAMDQLKKAFKGMFGKKKAKKGEAAPTATTEQPSTSTTKPTETTPAAPAPATAPEPAGSETAPASTGTAPASAPAPAPAAAPVPAPAAAPAQEEPKKDETAPVAEVREATSTPEPAGAVVPAPPTAVSAQAPATDAPAATEAKPTDAAAPAAEAPPAIPATQPAPGMSATSGPLDEPDFGVEKKPEPTAAPATAPATAAAPAASGPAPTATAPAEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.25
3 0.29
4 0.38
5 0.46
6 0.5
7 0.55
8 0.65
9 0.7
10 0.78
11 0.81
12 0.77
13 0.74
14 0.71
15 0.72
16 0.71
17 0.68
18 0.61
19 0.56
20 0.53
21 0.47
22 0.4
23 0.3
24 0.21
25 0.18
26 0.19
27 0.2
28 0.18
29 0.22
30 0.23
31 0.26
32 0.26
33 0.27
34 0.31
35 0.29
36 0.31
37 0.29
38 0.3
39 0.27
40 0.25
41 0.24
42 0.18
43 0.18
44 0.16
45 0.12
46 0.11
47 0.11
48 0.12
49 0.13
50 0.13
51 0.1
52 0.09
53 0.09
54 0.09
55 0.09
56 0.07
57 0.07
58 0.07
59 0.08
60 0.07
61 0.08
62 0.07
63 0.07
64 0.08
65 0.07
66 0.07
67 0.07
68 0.07
69 0.07
70 0.07
71 0.08
72 0.08
73 0.08
74 0.08
75 0.08
76 0.07
77 0.07
78 0.07
79 0.07
80 0.07
81 0.07
82 0.08
83 0.08
84 0.13
85 0.15
86 0.16
87 0.19
88 0.22
89 0.22
90 0.21
91 0.22
92 0.18
93 0.18
94 0.19
95 0.16
96 0.14
97 0.13
98 0.13
99 0.12
100 0.11
101 0.09
102 0.1
103 0.09
104 0.09
105 0.09
106 0.09
107 0.08
108 0.08
109 0.08
110 0.05
111 0.05
112 0.05
113 0.06
114 0.05
115 0.05
116 0.05
117 0.06
118 0.06
119 0.07
120 0.07
121 0.07
122 0.08
123 0.08
124 0.09
125 0.08
126 0.09
127 0.08
128 0.07
129 0.07
130 0.08
131 0.09
132 0.08
133 0.11
134 0.1
135 0.11
136 0.12
137 0.12
138 0.11
139 0.11
140 0.12
141 0.09
142 0.1
143 0.09
144 0.09
145 0.09
146 0.07
147 0.06
148 0.07
149 0.08
150 0.07
151 0.06
152 0.07
153 0.09
154 0.12
155 0.12
156 0.11
157 0.12
158 0.11
159 0.12
160 0.12
161 0.11
162 0.09
163 0.1
164 0.1
165 0.08
166 0.09
167 0.1
168 0.1
169 0.09
170 0.1
171 0.12
172 0.12
173 0.16
174 0.17
175 0.18
176 0.2
177 0.21
178 0.21
179 0.21
180 0.26
181 0.28
182 0.28
183 0.27
184 0.27
185 0.26
186 0.25
187 0.24
188 0.19
189 0.14
190 0.12
191 0.11
192 0.08
193 0.07
194 0.06
195 0.08
196 0.08
197 0.07
198 0.07
199 0.08
200 0.09
201 0.09
202 0.11