Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2LPV9

Protein Details
Accession A0A1Y2LPV9    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
9-36EASLKPKKVCMHTRQSKKTKKNLLSFCAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, mito_nucl 12.5, nucl 9, cyto 4
Family & Domain DBs
Amino Acid Sequences MQEHLVAREASLKPKKVCMHTRQSKKTKKNLLSFCAFVKSKLRIGIVSTDWGRTPDLLDPFMAACGRLGETTMSPETWSAENSKQRVSRVCAAHPFRSRKLLERVC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.54
3 0.55
4 0.63
5 0.62
6 0.66
7 0.7
8 0.79
9 0.81
10 0.86
11 0.87
12 0.87
13 0.88
14 0.87
15 0.86
16 0.85
17 0.81
18 0.77
19 0.7
20 0.63
21 0.54
22 0.5
23 0.41
24 0.33
25 0.31
26 0.28
27 0.26
28 0.27
29 0.27
30 0.2
31 0.22
32 0.23
33 0.19
34 0.2
35 0.18
36 0.15
37 0.15
38 0.15
39 0.14
40 0.11
41 0.11
42 0.11
43 0.12
44 0.11
45 0.11
46 0.11
47 0.1
48 0.11
49 0.1
50 0.06
51 0.05
52 0.05
53 0.06
54 0.05
55 0.06
56 0.06
57 0.07
58 0.1
59 0.11
60 0.1
61 0.1
62 0.11
63 0.12
64 0.12
65 0.13
66 0.13
67 0.19
68 0.26
69 0.27
70 0.34
71 0.35
72 0.38
73 0.43
74 0.46
75 0.47
76 0.45
77 0.49
78 0.52
79 0.55
80 0.6
81 0.63
82 0.64
83 0.61
84 0.64
85 0.62
86 0.6