Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2LLB4

Protein Details
Accession A0A1Y2LLB4    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
30-57LQPRDRTLAQPPRRNKKLHPLLHARQARHydrophilic
115-134QPPFPRRLAEPQRRARQHEVHydrophilic
NLS Segment(s)
PositionSequence
42-46RRNKK
309-340RRLGPKRRARHGPPEQLPPPIPRRYRLRHHAP
Subcellular Location(s) mito 19, cyto 5, nucl 3
Family & Domain DBs
Amino Acid Sequences MKTCSSTLHLSPRSNRHPPTNFHPERAPLLQPRDRTLAQPPRRNKKLHPLLHARQARHTRARHLVLVRIARLDETRHGARVRLVREGIGLLHGVDLVPVDGVARVLRGRDGVLDQPPFPRRLAEPQRRARQHEVAVQQAGAHVRGVVGDALCGASRRVQCFRAGEVGGGQVREEALEPEMEGRGGSVEPLAAAAAAAAAARPRAPEARGHKVLPLVEVVARQHGGGVQRPPAPHHLAQRPGEERIVDDGAPGERAGGVLPTGGDGERARPERLHVRPLQTSDLIRCVGATHVARDPPEHGLAILAVVPRRLGPKRRARHGPPEQLPPPIPRRYRLRHHAPSPRALAPDGNLAPIPPKRVDVLLDPLQRRPLIQQPRIQIHIPPAPHLPPGEEPEDVGAIVGVDDHVVILLARVQHGEPWRRDGELSGPADEPAAVEGQQHGSQRLAPRPRPRIHPQVQAVLGAVDAPLRAHVEAAVRRVDGAVADGERRLRRPEPVLAPRRGAEGDPPVVGEVVGGRRGAEERDVVEGYQGGWRGCWLRGGDGGCGGVGEESYEALAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.72
3 0.72
4 0.73
5 0.72
6 0.73
7 0.74
8 0.69
9 0.64
10 0.64
11 0.58
12 0.56
13 0.54
14 0.52
15 0.48
16 0.54
17 0.55
18 0.53
19 0.54
20 0.54
21 0.51
22 0.47
23 0.5
24 0.52
25 0.56
26 0.62
27 0.68
28 0.72
29 0.79
30 0.81
31 0.78
32 0.78
33 0.79
34 0.78
35 0.77
36 0.77
37 0.76
38 0.8
39 0.8
40 0.71
41 0.69
42 0.7
43 0.69
44 0.68
45 0.65
46 0.63
47 0.66
48 0.68
49 0.66
50 0.6
51 0.57
52 0.55
53 0.56
54 0.49
55 0.42
56 0.37
57 0.32
58 0.3
59 0.27
60 0.24
61 0.26
62 0.26
63 0.29
64 0.3
65 0.3
66 0.34
67 0.38
68 0.36
69 0.36
70 0.35
71 0.3
72 0.31
73 0.3
74 0.24
75 0.18
76 0.16
77 0.09
78 0.09
79 0.08
80 0.07
81 0.06
82 0.06
83 0.04
84 0.04
85 0.04
86 0.04
87 0.04
88 0.05
89 0.05
90 0.06
91 0.07
92 0.07
93 0.08
94 0.09
95 0.09
96 0.11
97 0.13
98 0.16
99 0.21
100 0.23
101 0.23
102 0.29
103 0.32
104 0.32
105 0.3
106 0.28
107 0.26
108 0.35
109 0.45
110 0.49
111 0.56
112 0.64
113 0.74
114 0.77
115 0.81
116 0.77
117 0.73
118 0.67
119 0.65
120 0.59
121 0.53
122 0.48
123 0.41
124 0.34
125 0.29
126 0.25
127 0.17
128 0.13
129 0.08
130 0.07
131 0.07
132 0.08
133 0.07
134 0.06
135 0.05
136 0.06
137 0.06
138 0.06
139 0.07
140 0.06
141 0.11
142 0.15
143 0.19
144 0.23
145 0.24
146 0.28
147 0.3
148 0.31
149 0.3
150 0.28
151 0.24
152 0.21
153 0.22
154 0.19
155 0.17
156 0.15
157 0.1
158 0.09
159 0.09
160 0.09
161 0.07
162 0.06
163 0.06
164 0.06
165 0.07
166 0.07
167 0.07
168 0.06
169 0.05
170 0.06
171 0.05
172 0.05
173 0.04
174 0.04
175 0.04
176 0.04
177 0.04
178 0.03
179 0.03
180 0.02
181 0.02
182 0.02
183 0.02
184 0.02
185 0.03
186 0.03
187 0.04
188 0.04
189 0.06
190 0.08
191 0.1
192 0.17
193 0.23
194 0.32
195 0.35
196 0.36
197 0.35
198 0.36
199 0.35
200 0.29
201 0.23
202 0.15
203 0.12
204 0.12
205 0.11
206 0.1
207 0.1
208 0.09
209 0.08
210 0.09
211 0.1
212 0.13
213 0.15
214 0.17
215 0.2
216 0.2
217 0.22
218 0.25
219 0.29
220 0.28
221 0.33
222 0.35
223 0.38
224 0.4
225 0.44
226 0.41
227 0.38
228 0.35
229 0.28
230 0.23
231 0.2
232 0.19
233 0.13
234 0.11
235 0.1
236 0.1
237 0.1
238 0.09
239 0.06
240 0.04
241 0.05
242 0.05
243 0.04
244 0.03
245 0.03
246 0.03
247 0.03
248 0.04
249 0.04
250 0.05
251 0.05
252 0.07
253 0.11
254 0.14
255 0.14
256 0.14
257 0.17
258 0.24
259 0.27
260 0.32
261 0.31
262 0.33
263 0.35
264 0.37
265 0.36
266 0.3
267 0.28
268 0.22
269 0.21
270 0.17
271 0.14
272 0.12
273 0.1
274 0.08
275 0.11
276 0.11
277 0.1
278 0.12
279 0.13
280 0.13
281 0.14
282 0.15
283 0.13
284 0.14
285 0.12
286 0.1
287 0.09
288 0.09
289 0.08
290 0.08
291 0.06
292 0.06
293 0.06
294 0.06
295 0.07
296 0.11
297 0.15
298 0.2
299 0.29
300 0.39
301 0.46
302 0.54
303 0.62
304 0.64
305 0.71
306 0.75
307 0.75
308 0.69
309 0.7
310 0.64
311 0.58
312 0.54
313 0.49
314 0.45
315 0.43
316 0.4
317 0.38
318 0.45
319 0.49
320 0.56
321 0.6
322 0.64
323 0.64
324 0.71
325 0.76
326 0.71
327 0.69
328 0.65
329 0.59
330 0.5
331 0.42
332 0.34
333 0.25
334 0.27
335 0.21
336 0.17
337 0.14
338 0.13
339 0.16
340 0.17
341 0.19
342 0.14
343 0.14
344 0.15
345 0.16
346 0.17
347 0.17
348 0.22
349 0.26
350 0.32
351 0.32
352 0.32
353 0.34
354 0.33
355 0.31
356 0.27
357 0.29
358 0.33
359 0.38
360 0.41
361 0.45
362 0.49
363 0.52
364 0.49
365 0.42
366 0.38
367 0.36
368 0.32
369 0.27
370 0.26
371 0.24
372 0.25
373 0.23
374 0.2
375 0.18
376 0.22
377 0.22
378 0.19
379 0.18
380 0.17
381 0.17
382 0.14
383 0.11
384 0.07
385 0.04
386 0.04
387 0.04
388 0.03
389 0.03
390 0.03
391 0.02
392 0.02
393 0.03
394 0.03
395 0.03
396 0.05
397 0.05
398 0.06
399 0.07
400 0.07
401 0.11
402 0.18
403 0.26
404 0.26
405 0.32
406 0.33
407 0.33
408 0.33
409 0.3
410 0.28
411 0.28
412 0.28
413 0.24
414 0.23
415 0.22
416 0.22
417 0.2
418 0.16
419 0.09
420 0.08
421 0.06
422 0.06
423 0.07
424 0.1
425 0.14
426 0.15
427 0.15
428 0.15
429 0.19
430 0.24
431 0.31
432 0.37
433 0.42
434 0.51
435 0.6
436 0.65
437 0.7
438 0.72
439 0.75
440 0.73
441 0.75
442 0.69
443 0.67
444 0.62
445 0.54
446 0.46
447 0.35
448 0.28
449 0.18
450 0.13
451 0.06
452 0.05
453 0.05
454 0.05
455 0.07
456 0.07
457 0.07
458 0.09
459 0.15
460 0.17
461 0.2
462 0.22
463 0.2
464 0.2
465 0.2
466 0.19
467 0.13
468 0.12
469 0.11
470 0.1
471 0.11
472 0.13
473 0.18
474 0.21
475 0.23
476 0.28
477 0.28
478 0.33
479 0.37
480 0.45
481 0.49
482 0.57
483 0.64
484 0.63
485 0.64
486 0.58
487 0.57
488 0.49
489 0.4
490 0.34
491 0.32
492 0.3
493 0.26
494 0.26
495 0.23
496 0.21
497 0.2
498 0.15
499 0.11
500 0.12
501 0.13
502 0.13
503 0.12
504 0.14
505 0.15
506 0.17
507 0.17
508 0.16
509 0.16
510 0.21
511 0.21
512 0.2
513 0.19
514 0.18
515 0.16
516 0.17
517 0.19
518 0.14
519 0.13
520 0.16
521 0.18
522 0.18
523 0.23
524 0.21
525 0.21
526 0.26
527 0.28
528 0.26
529 0.25
530 0.25
531 0.19
532 0.17
533 0.15
534 0.1
535 0.08
536 0.07
537 0.06
538 0.06