Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2LP17

Protein Details
Accession A0A1Y2LP17    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
42-73QSNPADKMRAKWRKKRVRRLKRKRRKTRARSKBasic
NLS Segment(s)
PositionSequence
48-73KMRAKWRKKRVRRLKRKRRKTRARSK
Subcellular Location(s) mito 14, nucl 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR007836  Ribosomal_L41  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF05162  Ribosomal_L41  
Amino Acid Sequences MKEACAVKLQGHPHAVTAFATHHKPKLRAQQLSFCNPRHSSQSNPADKMRAKWRKKRVRRLKRKRRKTRARSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.26
3 0.2
4 0.18
5 0.15
6 0.15
7 0.19
8 0.19
9 0.24
10 0.28
11 0.31
12 0.36
13 0.44
14 0.5
15 0.52
16 0.53
17 0.56
18 0.56
19 0.61
20 0.59
21 0.5
22 0.46
23 0.41
24 0.39
25 0.37
26 0.35
27 0.31
28 0.36
29 0.44
30 0.45
31 0.46
32 0.46
33 0.45
34 0.44
35 0.45
36 0.47
37 0.47
38 0.51
39 0.58
40 0.68
41 0.74
42 0.83
43 0.89
44 0.9
45 0.91
46 0.94
47 0.96
48 0.96
49 0.96
50 0.97
51 0.97
52 0.97
53 0.97