Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2LIS8

Protein Details
Accession A0A1Y2LIS8   
Localization Confidence Medium
Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
2-24AKGLRASSERTNRRKLRTKVFGPHydrophilic
74-107DSKTSTKKAHTNQRDQKTKKQHARKPRNSITFPTHydrophilic
NLS Segment(s)
PositionSequence
89-128QKTKKQHARKPRNSITFPTSRGKGALKPFTGKSRVGKNRK
Subcellular Location(s) nucl 15.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKGLRASSERTNRRKLRTKVFGPVETARAERLHAKLLATINSDKPAPPKNKVANETATEAKDDVEKDTSMDVDSKTSTKKAHTNQRDQKTKKQHARKPRNSITFPTSRGKGALKPFTGKSRVGKNRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.81
3 0.8
4 0.8
5 0.81
6 0.78
7 0.78
8 0.77
9 0.7
10 0.65
11 0.6
12 0.51
13 0.43
14 0.38
15 0.3
16 0.23
17 0.22
18 0.21
19 0.2
20 0.21
21 0.2
22 0.2
23 0.21
24 0.23
25 0.23
26 0.22
27 0.23
28 0.2
29 0.2
30 0.2
31 0.17
32 0.2
33 0.26
34 0.27
35 0.29
36 0.36
37 0.42
38 0.48
39 0.5
40 0.5
41 0.46
42 0.43
43 0.42
44 0.36
45 0.28
46 0.22
47 0.19
48 0.16
49 0.14
50 0.12
51 0.1
52 0.1
53 0.09
54 0.09
55 0.09
56 0.09
57 0.08
58 0.09
59 0.08
60 0.07
61 0.08
62 0.09
63 0.11
64 0.13
65 0.14
66 0.16
67 0.23
68 0.3
69 0.4
70 0.48
71 0.58
72 0.65
73 0.74
74 0.81
75 0.78
76 0.8
77 0.8
78 0.82
79 0.81
80 0.82
81 0.81
82 0.82
83 0.88
84 0.89
85 0.89
86 0.88
87 0.87
88 0.81
89 0.78
90 0.74
91 0.68
92 0.63
93 0.58
94 0.5
95 0.42
96 0.41
97 0.38
98 0.37
99 0.4
100 0.44
101 0.41
102 0.44
103 0.47
104 0.52
105 0.53
106 0.52
107 0.5
108 0.53