Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2LV35

Protein Details
Accession A0A1Y2LV35    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
82-103ESGGAGRGKRRRKGKERSQEKKBasic
NLS Segment(s)
PositionSequence
35-43KRSLRKPPR
84-103GGAGRGKRRRKGKERSQEKK
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 2
Family & Domain DBs
Amino Acid Sequences MAEEGEASTPQSQPAASAISPTTTKRPRSIDASLKRSLRKPPRRTSYELPGPSPLRNVVNASSLEVVRGEKRKAAEEEEEGESGGAGRGKRRRKGKERSQEKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.12
4 0.13
5 0.13
6 0.15
7 0.17
8 0.18
9 0.25
10 0.28
11 0.32
12 0.36
13 0.41
14 0.42
15 0.47
16 0.52
17 0.53
18 0.56
19 0.58
20 0.58
21 0.57
22 0.56
23 0.53
24 0.56
25 0.57
26 0.59
27 0.62
28 0.67
29 0.72
30 0.75
31 0.78
32 0.73
33 0.72
34 0.7
35 0.62
36 0.53
37 0.49
38 0.45
39 0.38
40 0.33
41 0.26
42 0.17
43 0.17
44 0.17
45 0.13
46 0.14
47 0.14
48 0.14
49 0.14
50 0.13
51 0.12
52 0.11
53 0.11
54 0.13
55 0.16
56 0.16
57 0.18
58 0.19
59 0.24
60 0.26
61 0.29
62 0.28
63 0.27
64 0.3
65 0.3
66 0.29
67 0.24
68 0.21
69 0.17
70 0.13
71 0.12
72 0.11
73 0.09
74 0.16
75 0.24
76 0.33
77 0.42
78 0.52
79 0.62
80 0.69
81 0.8
82 0.84
83 0.87