Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2M766

Protein Details
Accession A0A1Y2M766    Localization Confidence Medium Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
133-159DVKAAETKTVKKPKKKAKAVKLTFGDEHydrophilic
NLS Segment(s)
PositionSequence
98-118GKSRDKIAEVGANAKKRKAAK
137-151AETKTVKKPKKKAKA
Subcellular Location(s) nucl 22.5, cyto_nucl 14.333, mito_nucl 12.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR027911  DUF4604  
Pfam View protein in Pfam  
PF15377  DUF4604  
Amino Acid Sequences MSFKAKDLQFDNSQPAFLQRLRGQLQGDDSARHERPIPRNKRMKQDDEDDAPTYVLEDTNESMTKEEYEAFVAEKDPKEDAASEQEGASKEPGKAADGKSRDKIAEVGANAKKRKAAKVIGDEQEDSKDEPKDVKAAETKTVKKPKKKAKAVKLTFGDEEEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.33
3 0.3
4 0.25
5 0.3
6 0.24
7 0.32
8 0.34
9 0.37
10 0.36
11 0.34
12 0.36
13 0.34
14 0.33
15 0.27
16 0.27
17 0.31
18 0.3
19 0.29
20 0.3
21 0.32
22 0.41
23 0.5
24 0.56
25 0.59
26 0.69
27 0.73
28 0.79
29 0.8
30 0.78
31 0.72
32 0.69
33 0.65
34 0.6
35 0.57
36 0.48
37 0.4
38 0.32
39 0.26
40 0.21
41 0.15
42 0.1
43 0.07
44 0.07
45 0.07
46 0.09
47 0.1
48 0.09
49 0.1
50 0.1
51 0.1
52 0.09
53 0.09
54 0.07
55 0.08
56 0.08
57 0.08
58 0.08
59 0.08
60 0.1
61 0.1
62 0.11
63 0.1
64 0.1
65 0.1
66 0.1
67 0.1
68 0.12
69 0.12
70 0.12
71 0.11
72 0.13
73 0.13
74 0.13
75 0.13
76 0.11
77 0.1
78 0.11
79 0.11
80 0.1
81 0.14
82 0.15
83 0.21
84 0.24
85 0.27
86 0.28
87 0.3
88 0.29
89 0.26
90 0.25
91 0.2
92 0.19
93 0.17
94 0.22
95 0.24
96 0.31
97 0.31
98 0.31
99 0.33
100 0.32
101 0.36
102 0.35
103 0.38
104 0.39
105 0.47
106 0.54
107 0.54
108 0.54
109 0.5
110 0.44
111 0.4
112 0.33
113 0.27
114 0.22
115 0.19
116 0.17
117 0.18
118 0.19
119 0.21
120 0.2
121 0.24
122 0.27
123 0.28
124 0.35
125 0.4
126 0.45
127 0.5
128 0.61
129 0.64
130 0.68
131 0.76
132 0.79
133 0.83
134 0.88
135 0.89
136 0.89
137 0.92
138 0.89
139 0.89
140 0.83
141 0.78
142 0.68