FuNGI

A0A1Y2M067

Protein Details

Accession

A0A1Y2M067

Localization Confidence

Medium

Confidence Score

11.6

NoLS Segment(s)

Position	Sequence	Protein Nature
266-291	AEEKPKEEEKKDKKKKQPAPFNTTAD	Basic

NLS Segment(s)

Position	Sequence
270-282	PKEEEKKDKKKKQ

Subcellular Location(s)

nucl 12.5, cyto_nucl 10.5, cyto 7.5, pero 4

Family & Domain DBs

InterPro	View protein in InterPro IPR021056 Mt_import_IM_translocase_Tim54
Gene Ontology	GO:0005743 C:mitochondrial inner membrane
Pfam	View protein in Pfam PF11711 Tim54

Amino Acid Sequences

MAEPDAKGATAGGASAGPAKAPKPQNPVFRMMGLPNIRMKLPSRNWCIFWGVVGTWTAAVQYDRYEKRCIQRRYARLVEHIAKEPLDAQQLPRKLSIYISAPPADSLVSAREHFTEYIKPILVAAALDWDAVEGRREGDVRAGLAERIRKLRYKRGEQMKEPIELGTEDDIEALRQRAGVKEWNGPAGDIVVGRHTWKEYVRGLHEGWLGPLDPPAPAEVPAELALAVTEPTPAATTAPVAADPLVTVHSSTTDDASPTASPEAQAEEKPKEEEKKDKKKKQPAPFNTTADYEHSAVAQTCPRSLGPTAVVPLPHLLGFWNFPIRIYRYFNKRKVAEEVGRETAAAVLGAYRSFEAAGEAPSEDDSSAQWEQQRLLAHEEADFHKSVRDRKDDNGKERVWLDDVVLDPRIAERMKRFVLEPEAEDRAKNIDTSSDKSWIKSLWPAEKQKPLWEGLTEDE

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.06
2	0.09
3	0.09
4	0.09
5	0.11
6	0.12
7	0.2
8	0.28
9	0.35
10	0.41
11	0.49
12	0.58
13	0.61
14	0.66
15	0.6
16	0.56
17	0.52
18	0.44
19	0.45
20	0.38
21	0.37
22	0.36
23	0.35
24	0.32
25	0.32
26	0.34
27	0.36
28	0.42
29	0.48
30	0.51
31	0.54
32	0.56
33	0.56
34	0.57
35	0.46
36	0.38
37	0.31
38	0.23
39	0.2
40	0.18
41	0.16
42	0.12
43	0.12
44	0.11
45	0.09
46	0.09
47	0.08
48	0.11
49	0.2
50	0.25
51	0.28
52	0.34
53	0.38
54	0.48
55	0.57
56	0.6
57	0.62
58	0.67
59	0.72
60	0.76
61	0.77
62	0.71
63	0.66
64	0.68
65	0.64
66	0.58
67	0.54
68	0.47
69	0.39
70	0.36
71	0.32
72	0.26
73	0.24
74	0.21
75	0.2
76	0.26
77	0.3
78	0.31
79	0.32
80	0.3
81	0.26
82	0.26
83	0.27
84	0.23
85	0.23
86	0.25
87	0.24
88	0.23
89	0.23
90	0.22
91	0.18
92	0.14
93	0.11
94	0.1
95	0.11
96	0.12
97	0.12
98	0.13
99	0.15
100	0.15
101	0.17
102	0.19
103	0.18
104	0.21
105	0.2
106	0.19
107	0.17
108	0.16
109	0.14
110	0.1
111	0.08
112	0.07
113	0.06
114	0.06
115	0.06
116	0.06
117	0.06
118	0.06
119	0.07
120	0.06
121	0.06
122	0.08
123	0.09
124	0.09
125	0.12
126	0.12
127	0.12
128	0.13
129	0.13
130	0.12
131	0.14
132	0.18
133	0.18
134	0.22
135	0.24
136	0.28
137	0.33
138	0.42
139	0.48
140	0.54
141	0.6
142	0.66
143	0.72
144	0.7
145	0.74
146	0.67
147	0.59
148	0.51
149	0.41
150	0.31
151	0.24
152	0.21
153	0.13
154	0.1
155	0.08
156	0.08
157	0.08
158	0.07
159	0.08
160	0.07
161	0.06
162	0.07
163	0.08
164	0.09
165	0.11
166	0.17
167	0.18
168	0.23
169	0.24
170	0.25
171	0.25
172	0.23
173	0.21
174	0.16
175	0.13
176	0.08
177	0.07
178	0.06
179	0.06
180	0.07
181	0.08
182	0.08
183	0.09
184	0.1
185	0.14
186	0.16
187	0.2
188	0.21
189	0.24
190	0.24
191	0.25
192	0.26
193	0.21
194	0.18
195	0.15
196	0.13
197	0.1
198	0.1
199	0.07
200	0.05
201	0.06
202	0.06
203	0.06
204	0.06
205	0.07
206	0.06
207	0.07
208	0.07
209	0.07
210	0.06
211	0.05
212	0.04
213	0.04
214	0.04
215	0.03
216	0.03
217	0.03
218	0.03
219	0.04
220	0.04
221	0.04
222	0.04
223	0.04
224	0.05
225	0.05
226	0.05
227	0.05
228	0.05
229	0.04
230	0.04
231	0.04
232	0.04
233	0.04
234	0.05
235	0.04
236	0.05
237	0.07
238	0.07
239	0.08
240	0.07
241	0.08
242	0.08
243	0.09
244	0.08
245	0.08
246	0.09
247	0.07
248	0.07
249	0.07
250	0.1
251	0.1
252	0.12
253	0.14
254	0.15
255	0.17
256	0.19
257	0.22
258	0.24
259	0.27
260	0.36
261	0.43
262	0.53
263	0.63
264	0.71
265	0.77
266	0.83
267	0.89
268	0.89
269	0.89
270	0.87
271	0.86
272	0.83
273	0.77
274	0.68
275	0.6
276	0.5
277	0.42
278	0.35
279	0.26
280	0.19
281	0.15
282	0.14
283	0.13
284	0.14
285	0.14
286	0.12
287	0.11
288	0.13
289	0.13
290	0.14
291	0.15
292	0.15
293	0.14
294	0.14
295	0.16
296	0.16
297	0.16
298	0.14
299	0.14
300	0.12
301	0.1
302	0.09
303	0.08
304	0.08
305	0.09
306	0.1
307	0.13
308	0.12
309	0.13
310	0.17
311	0.2
312	0.24
313	0.29
314	0.34
315	0.41
316	0.51
317	0.57
318	0.62
319	0.61
320	0.6
321	0.6
322	0.62
323	0.57
324	0.53
325	0.52
326	0.46
327	0.44
328	0.4
329	0.33
330	0.25
331	0.19
332	0.13
333	0.07
334	0.05
335	0.05
336	0.05
337	0.06
338	0.05
339	0.05
340	0.05
341	0.06
342	0.07
343	0.07
344	0.08
345	0.09
346	0.09
347	0.09
348	0.1
349	0.1
350	0.08
351	0.08
352	0.07
353	0.11
354	0.12
355	0.14
356	0.16
357	0.17
358	0.18
359	0.21
360	0.24
361	0.21
362	0.26
363	0.25
364	0.23
365	0.23
366	0.25
367	0.24
368	0.24
369	0.23
370	0.18
371	0.2
372	0.24
373	0.3
374	0.35
375	0.41
376	0.41
377	0.48
378	0.6
379	0.64
380	0.67
381	0.69
382	0.62
383	0.58
384	0.56
385	0.51
386	0.42
387	0.33
388	0.27
389	0.22
390	0.22
391	0.2
392	0.2
393	0.17
394	0.14
395	0.14
396	0.18
397	0.15
398	0.19
399	0.21
400	0.28
401	0.31
402	0.33
403	0.33
404	0.35
405	0.41
406	0.4
407	0.38
408	0.36
409	0.39
410	0.38
411	0.36
412	0.32
413	0.28
414	0.26
415	0.23
416	0.18
417	0.2
418	0.24
419	0.29
420	0.32
421	0.36
422	0.36
423	0.37
424	0.4
425	0.34
426	0.33
427	0.35
428	0.39
429	0.41
430	0.49
431	0.57
432	0.61
433	0.7
434	0.69
435	0.69
436	0.65
437	0.59
438	0.53
439	0.46

A0A1Y2M067

3D AlphaFold-predicted Structure Viewer