Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2LKB4

Protein Details
Accession A0A1Y2LKB4    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
101-120GAEQRKWKMGRKKPQQDAFDHydrophilic
144-165GRIKHSKDTGLRPKNQRKIAKABasic
NLS Segment(s)
PositionSequence
154-168LRPKNQRKIAKAIRR
Subcellular Location(s) mito 15.5, cyto_mito 10.333, nucl 7.5, cyto_nucl 6.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR001648  Ribosomal_S18  
IPR036870  Ribosomal_S18_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01084  Ribosomal_S18  
Amino Acid Sequences MSFTRAALLRRSNGLRCFSSGAPRQNANDILNILGDIKTSDGARPASPGTLAPTQIARDLGFNRPSQTREMIESERREQFQRQIYRKWQPGDVYSPHDLTGAEQRKWKMGRKKPQQDAFDVLGINPLNEYKNFTIMSEYMTETGRIKHSKDTGLRPKNQRKIAKAIRRAIGLGLMPSVHRHPLVVKGSPASRFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.45
3 0.43
4 0.44
5 0.39
6 0.43
7 0.44
8 0.47
9 0.46
10 0.47
11 0.46
12 0.47
13 0.49
14 0.41
15 0.36
16 0.29
17 0.24
18 0.21
19 0.19
20 0.15
21 0.11
22 0.09
23 0.07
24 0.07
25 0.08
26 0.08
27 0.09
28 0.11
29 0.13
30 0.13
31 0.15
32 0.15
33 0.14
34 0.14
35 0.14
36 0.15
37 0.16
38 0.16
39 0.15
40 0.16
41 0.16
42 0.16
43 0.17
44 0.12
45 0.13
46 0.15
47 0.19
48 0.21
49 0.22
50 0.23
51 0.25
52 0.26
53 0.26
54 0.27
55 0.23
56 0.22
57 0.26
58 0.27
59 0.31
60 0.33
61 0.34
62 0.35
63 0.35
64 0.34
65 0.32
66 0.34
67 0.36
68 0.42
69 0.42
70 0.45
71 0.51
72 0.57
73 0.6
74 0.56
75 0.5
76 0.43
77 0.41
78 0.39
79 0.34
80 0.31
81 0.27
82 0.26
83 0.23
84 0.22
85 0.19
86 0.14
87 0.21
88 0.21
89 0.2
90 0.23
91 0.24
92 0.29
93 0.32
94 0.39
95 0.4
96 0.45
97 0.55
98 0.62
99 0.72
100 0.76
101 0.81
102 0.76
103 0.69
104 0.65
105 0.56
106 0.47
107 0.37
108 0.27
109 0.22
110 0.19
111 0.16
112 0.11
113 0.09
114 0.09
115 0.09
116 0.14
117 0.11
118 0.15
119 0.15
120 0.15
121 0.17
122 0.16
123 0.17
124 0.15
125 0.15
126 0.12
127 0.13
128 0.14
129 0.12
130 0.14
131 0.18
132 0.19
133 0.2
134 0.25
135 0.28
136 0.35
137 0.4
138 0.48
139 0.53
140 0.6
141 0.67
142 0.72
143 0.78
144 0.8
145 0.84
146 0.81
147 0.76
148 0.78
149 0.8
150 0.79
151 0.78
152 0.76
153 0.71
154 0.65
155 0.6
156 0.5
157 0.42
158 0.33
159 0.24
160 0.17
161 0.14
162 0.12
163 0.14
164 0.16
165 0.16
166 0.15
167 0.15
168 0.16
169 0.25
170 0.3
171 0.31
172 0.31
173 0.33
174 0.38