Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2LHI3

Protein Details
Accession A0A1Y2LHI3    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MAARKTTNKVHNKKLRRRREGLSTKCYHydrophilic
NLS Segment(s)
PositionSequence
12-19NKKLRRRR
Subcellular Location(s) nucl 18, cyto 5, mito 4
Family & Domain DBs
Amino Acid Sequences MAARKTTNKVHNKKLRRRREGLSTKCYEYGELDGMAHPKAKTEYPEDLKGRVEDTRRKTRMAKEAGVLVQAGTDGRGGQEAGSALVPMLSAADFPDFVCNLTLLRNRSKER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.9
3 0.89
4 0.87
5 0.82
6 0.83
7 0.82
8 0.8
9 0.79
10 0.72
11 0.65
12 0.61
13 0.55
14 0.45
15 0.36
16 0.3
17 0.22
18 0.17
19 0.15
20 0.13
21 0.14
22 0.13
23 0.14
24 0.11
25 0.11
26 0.13
27 0.14
28 0.15
29 0.19
30 0.26
31 0.28
32 0.35
33 0.35
34 0.35
35 0.34
36 0.32
37 0.29
38 0.24
39 0.24
40 0.25
41 0.31
42 0.4
43 0.4
44 0.43
45 0.46
46 0.49
47 0.53
48 0.51
49 0.46
50 0.37
51 0.38
52 0.36
53 0.32
54 0.25
55 0.16
56 0.1
57 0.08
58 0.07
59 0.04
60 0.04
61 0.04
62 0.04
63 0.04
64 0.05
65 0.04
66 0.06
67 0.06
68 0.06
69 0.06
70 0.06
71 0.05
72 0.05
73 0.05
74 0.04
75 0.04
76 0.03
77 0.03
78 0.04
79 0.05
80 0.06
81 0.06
82 0.1
83 0.1
84 0.11
85 0.11
86 0.11
87 0.11
88 0.17
89 0.22
90 0.23
91 0.32