Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2LN57

Protein Details
Accession A0A1Y2LN57    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
231-255PPPPSAKSVKEERRRSRQNFEPTPEHydrophilic
NLS Segment(s)
PositionSequence
165-168KAKK
Subcellular Location(s) mito 10, nucl 7.5, cyto_nucl 7.5, cyto 4.5, extr 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012466  NECAP_PHear  
IPR011993  PH-like_dom_sf  
Gene Ontology GO:0016020  C:membrane  
GO:0006897  P:endocytosis  
Pfam View protein in Pfam  
PF07933  DUF1681  
CDD cd13228  PHear_NECAP  
Amino Acid Sequences MNTDPLTGQPLPASAIQRVLFIAPKVHVYQIPPATSTKGYQASSWTADNNKMQIFTARLRIIETSIPPERDDGDEKVSTSILLEDSKSGDLFAAAPYTSERAVEQALDSSRFFAITVVGEGRKAVLGMGFEERSEAFDFSIALQDARKALGFDAASSGSAGAKAKAKKEAEEPKRDFSLKEGETISINLGGLKGRRQRPESEKSPGEQKTEQEALFSIAPPPGSGGAPFLPPPPSAKSVKEERRRSRQNFEPTPEDLGFDDGEFGEFQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.22
3 0.22
4 0.22
5 0.22
6 0.21
7 0.2
8 0.19
9 0.21
10 0.16
11 0.2
12 0.2
13 0.22
14 0.23
15 0.23
16 0.3
17 0.32
18 0.32
19 0.3
20 0.3
21 0.31
22 0.31
23 0.29
24 0.27
25 0.28
26 0.27
27 0.26
28 0.28
29 0.29
30 0.3
31 0.3
32 0.27
33 0.24
34 0.28
35 0.29
36 0.29
37 0.26
38 0.24
39 0.23
40 0.23
41 0.24
42 0.22
43 0.27
44 0.25
45 0.24
46 0.25
47 0.25
48 0.24
49 0.23
50 0.22
51 0.21
52 0.24
53 0.25
54 0.24
55 0.24
56 0.24
57 0.24
58 0.26
59 0.22
60 0.22
61 0.22
62 0.22
63 0.22
64 0.2
65 0.17
66 0.13
67 0.12
68 0.08
69 0.08
70 0.08
71 0.08
72 0.09
73 0.1
74 0.09
75 0.09
76 0.07
77 0.07
78 0.07
79 0.07
80 0.06
81 0.05
82 0.06
83 0.06
84 0.08
85 0.07
86 0.07
87 0.07
88 0.07
89 0.08
90 0.08
91 0.07
92 0.09
93 0.1
94 0.11
95 0.11
96 0.11
97 0.11
98 0.11
99 0.1
100 0.08
101 0.07
102 0.06
103 0.07
104 0.07
105 0.07
106 0.07
107 0.07
108 0.07
109 0.06
110 0.06
111 0.05
112 0.04
113 0.04
114 0.05
115 0.07
116 0.07
117 0.07
118 0.08
119 0.08
120 0.09
121 0.09
122 0.09
123 0.07
124 0.07
125 0.07
126 0.07
127 0.09
128 0.07
129 0.06
130 0.06
131 0.07
132 0.07
133 0.07
134 0.07
135 0.06
136 0.06
137 0.09
138 0.09
139 0.08
140 0.09
141 0.09
142 0.09
143 0.09
144 0.09
145 0.05
146 0.06
147 0.07
148 0.06
149 0.12
150 0.14
151 0.16
152 0.23
153 0.24
154 0.25
155 0.33
156 0.43
157 0.46
158 0.54
159 0.56
160 0.53
161 0.56
162 0.55
163 0.46
164 0.39
165 0.39
166 0.29
167 0.29
168 0.25
169 0.22
170 0.22
171 0.23
172 0.2
173 0.12
174 0.11
175 0.08
176 0.08
177 0.09
178 0.09
179 0.15
180 0.22
181 0.28
182 0.34
183 0.38
184 0.46
185 0.52
186 0.6
187 0.6
188 0.61
189 0.57
190 0.53
191 0.59
192 0.54
193 0.51
194 0.45
195 0.41
196 0.4
197 0.41
198 0.39
199 0.31
200 0.28
201 0.25
202 0.23
203 0.21
204 0.15
205 0.12
206 0.12
207 0.11
208 0.12
209 0.11
210 0.1
211 0.1
212 0.11
213 0.11
214 0.13
215 0.14
216 0.15
217 0.16
218 0.16
219 0.19
220 0.22
221 0.25
222 0.27
223 0.3
224 0.35
225 0.43
226 0.53
227 0.6
228 0.66
229 0.71
230 0.78
231 0.85
232 0.86
233 0.85
234 0.84
235 0.85
236 0.83
237 0.8
238 0.74
239 0.66
240 0.66
241 0.57
242 0.48
243 0.38
244 0.31
245 0.25
246 0.19
247 0.18
248 0.11