Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2LN29

Protein Details
Accession A0A1Y2LN29    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
134-164DTARRADRGCKRDRRGWRARKRTQSMGRIGGBasic
NLS Segment(s)
PositionSequence
16-48RRREGGREGGRGRLQVPGLKQEREQGRERDRGR
141-155RGCKRDRRGWRARKR
Subcellular Location(s) nucl 12.5, cyto_nucl 10.5, cyto 7.5, mito 6
Family & Domain DBs
Amino Acid Sequences MPGSREYYASWAFRVRRREGGREGGRGRLQVPGLKQEREQGRERDRGRTRTSARLATRPSGADDDDNDDNDGDHNAIHVDVDVDIDADELQAPAAPAPAPAPAPFPRGPSARVKHDKDKDKDKYKSLVMVFGADTARRADRGCKRDRRGWRARKRTQSMGRIGGAVPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.45
3 0.5
4 0.54
5 0.6
6 0.59
7 0.64
8 0.64
9 0.65
10 0.62
11 0.59
12 0.55
13 0.49
14 0.43
15 0.37
16 0.33
17 0.28
18 0.28
19 0.31
20 0.33
21 0.33
22 0.34
23 0.37
24 0.42
25 0.43
26 0.47
27 0.46
28 0.48
29 0.56
30 0.57
31 0.6
32 0.6
33 0.62
34 0.61
35 0.62
36 0.59
37 0.59
38 0.62
39 0.59
40 0.55
41 0.55
42 0.53
43 0.46
44 0.44
45 0.35
46 0.33
47 0.26
48 0.24
49 0.18
50 0.16
51 0.18
52 0.17
53 0.17
54 0.15
55 0.13
56 0.12
57 0.11
58 0.11
59 0.06
60 0.05
61 0.05
62 0.04
63 0.04
64 0.04
65 0.04
66 0.03
67 0.03
68 0.04
69 0.03
70 0.03
71 0.03
72 0.03
73 0.03
74 0.03
75 0.03
76 0.03
77 0.03
78 0.03
79 0.03
80 0.03
81 0.04
82 0.04
83 0.04
84 0.04
85 0.05
86 0.06
87 0.06
88 0.1
89 0.11
90 0.17
91 0.17
92 0.2
93 0.23
94 0.24
95 0.27
96 0.32
97 0.35
98 0.4
99 0.48
100 0.51
101 0.57
102 0.64
103 0.71
104 0.69
105 0.75
106 0.75
107 0.76
108 0.76
109 0.72
110 0.68
111 0.61
112 0.61
113 0.51
114 0.45
115 0.35
116 0.31
117 0.26
118 0.23
119 0.22
120 0.15
121 0.15
122 0.13
123 0.13
124 0.13
125 0.14
126 0.21
127 0.3
128 0.38
129 0.48
130 0.56
131 0.62
132 0.7
133 0.8
134 0.81
135 0.83
136 0.85
137 0.87
138 0.87
139 0.9
140 0.92
141 0.89
142 0.9
143 0.88
144 0.86
145 0.83
146 0.78
147 0.69
148 0.6