Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2LSE9

Protein Details
Accession A0A1Y2LSE9    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
29-57ALPAEKEKTKTKRTAKKRAKYKPVGMFAPHydrophilic
NLS Segment(s)
PositionSequence
34-50KEKTKTKRTAKKRAKYK
Subcellular Location(s) cysk 11, cyto 7.5, cyto_nucl 7.5, nucl 6.5
Family & Domain DBs
Amino Acid Sequences MAEPIPPEEQSNYETFRDCMSEPIMKALALPAEKEKTKTKRTAKKRAKYKPVGMFAPAKPQTEAPATSTPSGTDAEDLGEFIDYLSSLLFPSLPPDLRTLSYPRYRDTPALQDAYSTPLAASTYTSLLSSVPPDAIDSLESYALLPPSSDTHDAHNLLTPVFTAYCAAATLPPPIWATTRTAECELCDRGWVPLTYHHLIPKSTHDRVRKRGWHGEEVLNSVAWLCRACHSFVHRLASNEELARYYYTVELIREGGVEGDEEKAQVVEGWVKWVSGVRWKAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.25
3 0.25
4 0.25
5 0.23
6 0.22
7 0.23
8 0.26
9 0.25
10 0.28
11 0.27
12 0.24
13 0.23
14 0.22
15 0.21
16 0.17
17 0.18
18 0.19
19 0.24
20 0.26
21 0.3
22 0.37
23 0.42
24 0.5
25 0.58
26 0.63
27 0.68
28 0.77
29 0.85
30 0.86
31 0.87
32 0.9
33 0.91
34 0.92
35 0.91
36 0.9
37 0.88
38 0.84
39 0.76
40 0.69
41 0.65
42 0.55
43 0.55
44 0.49
45 0.41
46 0.35
47 0.34
48 0.33
49 0.3
50 0.3
51 0.24
52 0.26
53 0.27
54 0.26
55 0.26
56 0.23
57 0.21
58 0.21
59 0.16
60 0.12
61 0.1
62 0.1
63 0.09
64 0.09
65 0.08
66 0.06
67 0.06
68 0.05
69 0.05
70 0.04
71 0.04
72 0.04
73 0.04
74 0.04
75 0.04
76 0.04
77 0.04
78 0.06
79 0.09
80 0.1
81 0.11
82 0.13
83 0.15
84 0.15
85 0.18
86 0.2
87 0.24
88 0.29
89 0.3
90 0.3
91 0.32
92 0.33
93 0.34
94 0.33
95 0.32
96 0.3
97 0.31
98 0.29
99 0.25
100 0.23
101 0.25
102 0.21
103 0.15
104 0.11
105 0.09
106 0.09
107 0.08
108 0.09
109 0.06
110 0.06
111 0.07
112 0.07
113 0.06
114 0.07
115 0.07
116 0.07
117 0.06
118 0.06
119 0.05
120 0.06
121 0.06
122 0.06
123 0.06
124 0.05
125 0.06
126 0.05
127 0.05
128 0.05
129 0.06
130 0.06
131 0.05
132 0.05
133 0.05
134 0.06
135 0.09
136 0.11
137 0.11
138 0.13
139 0.17
140 0.18
141 0.18
142 0.18
143 0.16
144 0.14
145 0.13
146 0.1
147 0.08
148 0.07
149 0.07
150 0.05
151 0.05
152 0.05
153 0.05
154 0.05
155 0.05
156 0.06
157 0.08
158 0.07
159 0.09
160 0.1
161 0.1
162 0.11
163 0.12
164 0.14
165 0.16
166 0.17
167 0.18
168 0.2
169 0.19
170 0.19
171 0.21
172 0.2
173 0.17
174 0.17
175 0.14
176 0.14
177 0.16
178 0.16
179 0.13
180 0.16
181 0.23
182 0.24
183 0.25
184 0.27
185 0.26
186 0.26
187 0.27
188 0.31
189 0.32
190 0.36
191 0.41
192 0.48
193 0.54
194 0.61
195 0.7
196 0.69
197 0.69
198 0.72
199 0.71
200 0.69
201 0.65
202 0.63
203 0.55
204 0.5
205 0.43
206 0.33
207 0.28
208 0.21
209 0.16
210 0.11
211 0.1
212 0.08
213 0.11
214 0.13
215 0.15
216 0.2
217 0.25
218 0.32
219 0.36
220 0.42
221 0.4
222 0.4
223 0.41
224 0.39
225 0.37
226 0.3
227 0.27
228 0.21
229 0.2
230 0.19
231 0.16
232 0.15
233 0.13
234 0.14
235 0.15
236 0.14
237 0.15
238 0.14
239 0.14
240 0.13
241 0.12
242 0.1
243 0.09
244 0.09
245 0.08
246 0.09
247 0.09
248 0.09
249 0.09
250 0.08
251 0.08
252 0.08
253 0.09
254 0.12
255 0.12
256 0.17
257 0.17
258 0.17
259 0.17
260 0.2
261 0.21
262 0.25