FuNGI

A0A1Y2M4S1

Protein Details

Accession

A0A1Y2M4S1

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
93-128	EGEVKSRKWCRKCDAPKPPRAHHCKECKRCIPKMDH	Basic

NLS Segment(s)

Subcellular Location(s)

extr 12, mito 4, plas 3, pero 2, E.R. 2, golg 2, mito_nucl 2

Family & Domain DBs

InterPro	View protein in InterPro IPR001594 Palmitoyltrfase_DHHC IPR033682 PFA4
Gene Ontology	GO:0005789 C:endoplasmic reticulum membrane GO:0019706 F:protein-cysteine S-palmitoyltransferase activity GO:0018345 P:protein palmitoylation
Pfam	View protein in Pfam PF01529 DHHC
PROSITE	View protein in PROSITE PS50216 DHHC

Amino Acid Sequences

MSSLSHLSVPFVCALIFFLGYPSQWLLMRLDPGPLTKNQLVTANVVLVLIWITYARSVLVDPGTIPRDWAETEVGKGGGKSVGEEGRGKGEGEGEVKSRKWCRKCDAPKPPRAHHCKECKRCIPKMDHHCPWTANCVSHTTFPHFLRFLLSATLGLSLFQSHHFTRLAHLWATRDMPSYLGPSLLELALLFASFAINSITLFALAILALRNLWSLAVNTTTIEGWEIARHDTLLRRARAFGGYLSTPEGARVRIQRQEFPYDIGFFANVAQGMGSANPLTWLNPFSATPSLQSGLSFPVNGFESDDKPWPPPDPDRAYRRREMGDAGPAFTYRDAELNDEETLRAFRDRQAQDAVRRRKPFVQRMEAVRDSAHHGSARGDYGYAGSEGGEVDDDGDDSENAEDEGRKYGEGDEGEEAWRNSEGERLKDFGVDEDVEFYDEQEDEVPLSVLIKRRQAAAASGGEAVSSY

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.13
2	0.12
3	0.11
4	0.09
5	0.1
6	0.11
7	0.11
8	0.13
9	0.12
10	0.13
11	0.14
12	0.16
13	0.16
14	0.18
15	0.22
16	0.2
17	0.22
18	0.22
19	0.23
20	0.25
21	0.25
22	0.29
23	0.29
24	0.3
25	0.29
26	0.32
27	0.31
28	0.3
29	0.3
30	0.23
31	0.2
32	0.18
33	0.15
34	0.11
35	0.09
36	0.06
37	0.05
38	0.04
39	0.04
40	0.05
41	0.05
42	0.06
43	0.06
44	0.07
45	0.09
46	0.1
47	0.1
48	0.11
49	0.16
50	0.18
51	0.17
52	0.18
53	0.16
54	0.17
55	0.18
56	0.19
57	0.18
58	0.16
59	0.18
60	0.19
61	0.19
62	0.17
63	0.16
64	0.16
65	0.13
66	0.12
67	0.12
68	0.14
69	0.15
70	0.18
71	0.2
72	0.19
73	0.21
74	0.22
75	0.21
76	0.18
77	0.17
78	0.17
79	0.16
80	0.17
81	0.16
82	0.19
83	0.2
84	0.27
85	0.34
86	0.41
87	0.46
88	0.53
89	0.57
90	0.65
91	0.74
92	0.79
93	0.82
94	0.83
95	0.85
96	0.85
97	0.86
98	0.85
99	0.83
100	0.81
101	0.79
102	0.8
103	0.82
104	0.83
105	0.85
106	0.84
107	0.83
108	0.81
109	0.8
110	0.78
111	0.77
112	0.78
113	0.78
114	0.74
115	0.69
116	0.66
117	0.59
118	0.51
119	0.48
120	0.4
121	0.32
122	0.26
123	0.28
124	0.27
125	0.29
126	0.3
127	0.28
128	0.32
129	0.31
130	0.34
131	0.3
132	0.29
133	0.27
134	0.25
135	0.21
136	0.16
137	0.15
138	0.11
139	0.11
140	0.12
141	0.09
142	0.08
143	0.07
144	0.06
145	0.07
146	0.08
147	0.12
148	0.11
149	0.13
150	0.14
151	0.15
152	0.16
153	0.2
154	0.21
155	0.18
156	0.19
157	0.18
158	0.19
159	0.21
160	0.2
161	0.18
162	0.16
163	0.15
164	0.15
165	0.15
166	0.13
167	0.12
168	0.1
169	0.09
170	0.09
171	0.08
172	0.07
173	0.05
174	0.05
175	0.04
176	0.04
177	0.04
178	0.03
179	0.03
180	0.03
181	0.03
182	0.03
183	0.03
184	0.03
185	0.04
186	0.04
187	0.04
188	0.04
189	0.04
190	0.04
191	0.03
192	0.04
193	0.03
194	0.03
195	0.03
196	0.03
197	0.03
198	0.03
199	0.04
200	0.04
201	0.04
202	0.05
203	0.06
204	0.06
205	0.06
206	0.07
207	0.06
208	0.06
209	0.06
210	0.06
211	0.05
212	0.06
213	0.06
214	0.07
215	0.07
216	0.07
217	0.08
218	0.09
219	0.17
220	0.22
221	0.23
222	0.23
223	0.24
224	0.25
225	0.25
226	0.23
227	0.16
228	0.12
229	0.11
230	0.11
231	0.11
232	0.11
233	0.1
234	0.1
235	0.11
236	0.09
237	0.11
238	0.15
239	0.17
240	0.22
241	0.24
242	0.28
243	0.31
244	0.35
245	0.32
246	0.31
247	0.29
248	0.24
249	0.23
250	0.18
251	0.14
252	0.1
253	0.09
254	0.07
255	0.06
256	0.05
257	0.04
258	0.04
259	0.04
260	0.04
261	0.04
262	0.04
263	0.04
264	0.05
265	0.05
266	0.05
267	0.06
268	0.07
269	0.07
270	0.08
271	0.09
272	0.1
273	0.12
274	0.12
275	0.12
276	0.13
277	0.14
278	0.13
279	0.13
280	0.11
281	0.12
282	0.12
283	0.11
284	0.09
285	0.1
286	0.11
287	0.11
288	0.12
289	0.11
290	0.13
291	0.15
292	0.18
293	0.17
294	0.18
295	0.2
296	0.2
297	0.23
298	0.25
299	0.32
300	0.36
301	0.43
302	0.51
303	0.57
304	0.61
305	0.61
306	0.61
307	0.54
308	0.48
309	0.45
310	0.38
311	0.39
312	0.34
313	0.3
314	0.26
315	0.24
316	0.23
317	0.19
318	0.18
319	0.09
320	0.11
321	0.11
322	0.13
323	0.14
324	0.15
325	0.16
326	0.15
327	0.14
328	0.12
329	0.13
330	0.11
331	0.12
332	0.11
333	0.14
334	0.24
335	0.25
336	0.27
337	0.34
338	0.38
339	0.46
340	0.55
341	0.61
342	0.59
343	0.62
344	0.63
345	0.64
346	0.69
347	0.69
348	0.68
349	0.68
350	0.66
351	0.68
352	0.72
353	0.65
354	0.56
355	0.47
356	0.39
357	0.36
358	0.31
359	0.27
360	0.2
361	0.19
362	0.2
363	0.21
364	0.22
365	0.16
366	0.14
367	0.12
368	0.12
369	0.12
370	0.11
371	0.09
372	0.07
373	0.07
374	0.07
375	0.07
376	0.06
377	0.05
378	0.06
379	0.06
380	0.06
381	0.06
382	0.07
383	0.06
384	0.07
385	0.07
386	0.07
387	0.07
388	0.08
389	0.09
390	0.09
391	0.14
392	0.14
393	0.13
394	0.14
395	0.15
396	0.19
397	0.18
398	0.2
399	0.18
400	0.18
401	0.19
402	0.22
403	0.2
404	0.17
405	0.18
406	0.15
407	0.13
408	0.18
409	0.21
410	0.24
411	0.26
412	0.27
413	0.27
414	0.28
415	0.29
416	0.25
417	0.25
418	0.21
419	0.18
420	0.18
421	0.18
422	0.18
423	0.17
424	0.15
425	0.13
426	0.12
427	0.12
428	0.1
429	0.1
430	0.09
431	0.1
432	0.1
433	0.08
434	0.1
435	0.12
436	0.18
437	0.23
438	0.29
439	0.29
440	0.32
441	0.35
442	0.36
443	0.36
444	0.35
445	0.33
446	0.28
447	0.28
448	0.24

A0A1Y2M4S1

3D AlphaFold-predicted Structure Viewer