Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2LM95

Protein Details
Accession A0A1Y2LM95   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
99-128SIDPSIIPPKKEKKKKKAPNPIKKTHIASSHydrophilic
NLS Segment(s)
PositionSequence
106-122PPKKEKKKKKAPNPIKK
Subcellular Location(s) nucl 15.5, cyto_nucl 15, cyto 11.5
Family & Domain DBs
Amino Acid Sequences MAWMRHDNVCMIYTKHEDEDPSSTSTFAPLAVITPCCTRASAVIEEAPRSVRPSVSPDEFHAAIITLHLKQEITPCILYPSTAQRAQETEGSTHPVHRSIDPSIIPPKKEKKKKKAPNPIKKTHIASSTV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.26
3 0.25
4 0.25
5 0.26
6 0.28
7 0.26
8 0.25
9 0.23
10 0.21
11 0.2
12 0.19
13 0.16
14 0.12
15 0.1
16 0.07
17 0.08
18 0.09
19 0.1
20 0.1
21 0.12
22 0.13
23 0.13
24 0.14
25 0.12
26 0.13
27 0.17
28 0.17
29 0.17
30 0.19
31 0.19
32 0.19
33 0.19
34 0.18
35 0.14
36 0.15
37 0.14
38 0.11
39 0.12
40 0.16
41 0.2
42 0.21
43 0.22
44 0.21
45 0.25
46 0.24
47 0.23
48 0.18
49 0.14
50 0.11
51 0.1
52 0.09
53 0.06
54 0.06
55 0.06
56 0.06
57 0.06
58 0.09
59 0.1
60 0.11
61 0.11
62 0.11
63 0.13
64 0.13
65 0.13
66 0.12
67 0.16
68 0.19
69 0.2
70 0.21
71 0.2
72 0.22
73 0.23
74 0.25
75 0.21
76 0.18
77 0.17
78 0.22
79 0.21
80 0.22
81 0.21
82 0.21
83 0.22
84 0.21
85 0.24
86 0.21
87 0.25
88 0.23
89 0.26
90 0.32
91 0.34
92 0.35
93 0.39
94 0.48
95 0.54
96 0.65
97 0.72
98 0.73
99 0.81
100 0.9
101 0.93
102 0.94
103 0.95
104 0.96
105 0.95
106 0.93
107 0.9
108 0.86
109 0.81
110 0.76