Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2LW40

Protein Details
Accession A0A1Y2LW40    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
167-190GQGTAAEKPKRRKPWEKDEPAAVAHydrophilic
NLS Segment(s)
PositionSequence
174-179KPKRRK
Subcellular Location(s) cyto 10, nucl 9, cysk 5, mito_nucl 5
Family & Domain DBs
Pfam View protein in Pfam  
PF17733  DUF5572  
Amino Acid Sequences MSAAGIDAGAAAASGPNHVHEALERYHWDDDVEFQAGLSAILGSNSSPEQAAELALRARCFYYARKFNTAVDFEAYKAYRDAHGRPPPQTNGVQPLDFSEATYGMPDAAPPAPAPAHEASSGVLPAPANPSEPPAPYPTTFAHIVELITTGQPIPGIKEIPNTVLEGQGTAAEKPKRRKPWEKDEPAAVAQTGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.07
4 0.09
5 0.1
6 0.1
7 0.11
8 0.15
9 0.16
10 0.19
11 0.19
12 0.21
13 0.22
14 0.22
15 0.21
16 0.18
17 0.19
18 0.18
19 0.18
20 0.14
21 0.13
22 0.14
23 0.13
24 0.12
25 0.09
26 0.06
27 0.04
28 0.05
29 0.05
30 0.04
31 0.06
32 0.06
33 0.06
34 0.06
35 0.06
36 0.07
37 0.07
38 0.08
39 0.07
40 0.08
41 0.1
42 0.11
43 0.12
44 0.11
45 0.11
46 0.12
47 0.14
48 0.18
49 0.25
50 0.32
51 0.37
52 0.41
53 0.42
54 0.43
55 0.47
56 0.43
57 0.35
58 0.29
59 0.25
60 0.2
61 0.22
62 0.2
63 0.15
64 0.14
65 0.13
66 0.14
67 0.16
68 0.19
69 0.25
70 0.33
71 0.35
72 0.37
73 0.41
74 0.39
75 0.4
76 0.39
77 0.31
78 0.3
79 0.28
80 0.25
81 0.21
82 0.21
83 0.2
84 0.18
85 0.16
86 0.1
87 0.09
88 0.09
89 0.09
90 0.07
91 0.04
92 0.04
93 0.04
94 0.05
95 0.05
96 0.06
97 0.05
98 0.07
99 0.06
100 0.07
101 0.1
102 0.1
103 0.11
104 0.11
105 0.11
106 0.1
107 0.11
108 0.11
109 0.07
110 0.07
111 0.06
112 0.06
113 0.09
114 0.09
115 0.1
116 0.1
117 0.14
118 0.15
119 0.16
120 0.17
121 0.18
122 0.21
123 0.2
124 0.23
125 0.2
126 0.23
127 0.23
128 0.21
129 0.19
130 0.17
131 0.16
132 0.13
133 0.13
134 0.09
135 0.08
136 0.08
137 0.07
138 0.06
139 0.07
140 0.07
141 0.09
142 0.11
143 0.12
144 0.13
145 0.17
146 0.18
147 0.2
148 0.21
149 0.2
150 0.18
151 0.18
152 0.18
153 0.14
154 0.13
155 0.13
156 0.13
157 0.12
158 0.19
159 0.23
160 0.3
161 0.39
162 0.49
163 0.57
164 0.65
165 0.76
166 0.78
167 0.84
168 0.88
169 0.89
170 0.85
171 0.81
172 0.76
173 0.67
174 0.59