Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2LNF3

Protein Details
Accession A0A1Y2LNF3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
253-275VEGAPKKRFEAKRKELEDKRAAKBasic
NLS Segment(s)
PositionSequence
257-278PKKRFEAKRKELEDKRAAKAKI
Subcellular Location(s) cyto 14.5, cyto_nucl 8, pero 6, cysk 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR029045  ClpP/crotonase-like_dom_sf  
IPR001753  Enoyl-CoA_hydra/iso  
Gene Ontology GO:0003824  F:catalytic activity  
Pfam View protein in Pfam  
PF00378  ECH_1  
CDD cd06558  crotonase-like  
Amino Acid Sequences MADHQYTDIKFEIKGQIGIITFNRPKALNSFGGNIIENTISALRVLNEHPDTIFTVLTGEGRFFSAGADVKGIASNDAEPSDPAVRKMGMLQRFGYAQELLRSMIDHRKVLILALNGPAVGGGAAWFPGVADIVLASSSAWLQCPFSALGLVPENGSALSFAQHIGIHRANDFLMFGRKLSAQELLEAGLYNYVWEETGDAFQAKVVGFLEGQLEVNDGKSMCEMKRLQNEPIRDARLLAVVRAVDALAERFVEGAPKKRFEAKRKELEDKRAAKAKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.23
3 0.24
4 0.23
5 0.26
6 0.23
7 0.26
8 0.26
9 0.27
10 0.29
11 0.26
12 0.28
13 0.29
14 0.33
15 0.29
16 0.29
17 0.31
18 0.3
19 0.32
20 0.31
21 0.27
22 0.23
23 0.18
24 0.15
25 0.13
26 0.11
27 0.09
28 0.08
29 0.09
30 0.08
31 0.1
32 0.11
33 0.16
34 0.17
35 0.18
36 0.18
37 0.18
38 0.19
39 0.18
40 0.17
41 0.1
42 0.1
43 0.09
44 0.11
45 0.09
46 0.08
47 0.08
48 0.09
49 0.09
50 0.08
51 0.08
52 0.09
53 0.1
54 0.1
55 0.11
56 0.1
57 0.1
58 0.12
59 0.12
60 0.09
61 0.08
62 0.09
63 0.09
64 0.09
65 0.09
66 0.08
67 0.11
68 0.15
69 0.15
70 0.15
71 0.16
72 0.16
73 0.15
74 0.2
75 0.23
76 0.23
77 0.25
78 0.25
79 0.24
80 0.25
81 0.25
82 0.22
83 0.16
84 0.13
85 0.12
86 0.12
87 0.11
88 0.11
89 0.11
90 0.11
91 0.17
92 0.18
93 0.17
94 0.16
95 0.17
96 0.17
97 0.17
98 0.17
99 0.12
100 0.11
101 0.11
102 0.11
103 0.09
104 0.09
105 0.08
106 0.06
107 0.05
108 0.03
109 0.02
110 0.02
111 0.03
112 0.03
113 0.03
114 0.02
115 0.03
116 0.03
117 0.02
118 0.02
119 0.02
120 0.02
121 0.02
122 0.03
123 0.02
124 0.03
125 0.03
126 0.03
127 0.04
128 0.04
129 0.05
130 0.05
131 0.06
132 0.06
133 0.06
134 0.06
135 0.06
136 0.07
137 0.08
138 0.09
139 0.07
140 0.07
141 0.07
142 0.06
143 0.06
144 0.05
145 0.04
146 0.04
147 0.04
148 0.05
149 0.05
150 0.06
151 0.07
152 0.11
153 0.13
154 0.13
155 0.13
156 0.14
157 0.13
158 0.12
159 0.12
160 0.09
161 0.11
162 0.11
163 0.11
164 0.11
165 0.12
166 0.13
167 0.14
168 0.16
169 0.12
170 0.13
171 0.13
172 0.12
173 0.11
174 0.11
175 0.09
176 0.06
177 0.06
178 0.05
179 0.05
180 0.04
181 0.04
182 0.04
183 0.05
184 0.05
185 0.06
186 0.07
187 0.07
188 0.07
189 0.07
190 0.09
191 0.08
192 0.08
193 0.08
194 0.08
195 0.07
196 0.08
197 0.09
198 0.08
199 0.08
200 0.07
201 0.08
202 0.07
203 0.08
204 0.09
205 0.08
206 0.08
207 0.09
208 0.12
209 0.12
210 0.19
211 0.21
212 0.28
213 0.37
214 0.41
215 0.47
216 0.49
217 0.53
218 0.51
219 0.56
220 0.52
221 0.42
222 0.4
223 0.33
224 0.33
225 0.3
226 0.24
227 0.2
228 0.16
229 0.16
230 0.15
231 0.14
232 0.08
233 0.08
234 0.09
235 0.07
236 0.07
237 0.07
238 0.07
239 0.08
240 0.14
241 0.17
242 0.25
243 0.31
244 0.34
245 0.37
246 0.46
247 0.56
248 0.59
249 0.67
250 0.68
251 0.73
252 0.77
253 0.85
254 0.83
255 0.84
256 0.84
257 0.8
258 0.78