Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2M352

Protein Details
Accession A0A1Y2M352   
Localization Confidence Low
Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
68-94SACRKQDCPRSCRRRAARCAQPKKGDGHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 14, nucl 7, mito 3, cyto 1, plas 1, pero 1, cyto_pero 1
Family & Domain DBs
Amino Acid Sequences MTYDCSTLARCNILARVNSLLSLSLPIHQSAALTLLPEQTLTSNDQRAARQRDVLPWWRRGLFNVSGSACRKQDCPRSCRRRAARCAQPKKGDGVEASSGLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.26
4 0.24
5 0.23
6 0.21
7 0.17
8 0.13
9 0.14
10 0.12
11 0.11
12 0.12
13 0.12
14 0.12
15 0.11
16 0.11
17 0.09
18 0.1
19 0.08
20 0.07
21 0.07
22 0.07
23 0.07
24 0.07
25 0.07
26 0.06
27 0.07
28 0.1
29 0.12
30 0.13
31 0.15
32 0.17
33 0.19
34 0.26
35 0.31
36 0.28
37 0.3
38 0.29
39 0.31
40 0.34
41 0.41
42 0.38
43 0.36
44 0.38
45 0.35
46 0.35
47 0.33
48 0.33
49 0.28
50 0.25
51 0.26
52 0.24
53 0.27
54 0.29
55 0.31
56 0.26
57 0.24
58 0.25
59 0.29
60 0.38
61 0.42
62 0.47
63 0.54
64 0.63
65 0.7
66 0.77
67 0.8
68 0.8
69 0.81
70 0.84
71 0.84
72 0.85
73 0.88
74 0.87
75 0.84
76 0.76
77 0.73
78 0.65
79 0.58
80 0.49
81 0.44
82 0.37