Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2LQF6

Protein Details
Accession A0A1Y2LQF6   
Localization Confidence Low
Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
80-99KLCDGCKSVRRKKGRYVYIIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22.5, mito_nucl 13.833, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
Amino Acid Sequences MFARALLPPIRRTLFARSARSIHTCAASLTRPTLTSCASPTHSLISRFAGLRVAPTSESGILSKLGQQTRGMKVRSSVKKLCDGCKSVRRKKGRYVYIICSKNPKHKQRQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.47
3 0.51
4 0.48
5 0.49
6 0.51
7 0.52
8 0.46
9 0.38
10 0.32
11 0.26
12 0.23
13 0.23
14 0.21
15 0.19
16 0.18
17 0.17
18 0.16
19 0.17
20 0.18
21 0.16
22 0.15
23 0.16
24 0.17
25 0.18
26 0.19
27 0.19
28 0.21
29 0.22
30 0.22
31 0.21
32 0.2
33 0.19
34 0.18
35 0.17
36 0.15
37 0.12
38 0.12
39 0.11
40 0.1
41 0.09
42 0.09
43 0.1
44 0.08
45 0.09
46 0.08
47 0.08
48 0.08
49 0.08
50 0.1
51 0.14
52 0.14
53 0.15
54 0.17
55 0.21
56 0.27
57 0.33
58 0.31
59 0.27
60 0.31
61 0.4
62 0.45
63 0.48
64 0.46
65 0.44
66 0.51
67 0.54
68 0.56
69 0.53
70 0.5
71 0.5
72 0.54
73 0.62
74 0.62
75 0.68
76 0.72
77 0.71
78 0.77
79 0.8
80 0.8
81 0.79
82 0.76
83 0.76
84 0.76
85 0.74
86 0.67
87 0.66
88 0.63
89 0.64
90 0.68
91 0.69