Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2M0Z2

Protein Details
Accession A0A1Y2M0Z2    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
97-140GNTTPKKPTTPRKRAKKDVEDGEESPKKRGRPSKAKPQPEPEDEBasic
NLS Segment(s)
PositionSequence
79-133ATPKKGGGRKKKVDSGEGGNTTPKKPTTPRKRAKKDVEDGEESPKKRGRPSKAKP
Subcellular Location(s) nucl 17.5, cyto_nucl 13, cyto 5.5, mito 3
Family & Domain DBs
Amino Acid Sequences MSDTIKSPSHNTEAAPKFTERELQILGWAMQSLKSGPPEIDYDKLASFAGMTNPRSASNAWAVLKKKLMTPSDGSAPPATPKKGGGRKKKVDSGEGGNTTPKKPTTPRKRAKKDVEDGEESPKKRGRPSKAKPQPEPEDEEESKVKAEADSTDDLTPEDDAQAEEAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.4
3 0.36
4 0.34
5 0.33
6 0.39
7 0.29
8 0.28
9 0.26
10 0.23
11 0.23
12 0.23
13 0.22
14 0.16
15 0.15
16 0.11
17 0.1
18 0.11
19 0.11
20 0.11
21 0.12
22 0.13
23 0.13
24 0.15
25 0.18
26 0.2
27 0.21
28 0.19
29 0.19
30 0.18
31 0.19
32 0.17
33 0.13
34 0.1
35 0.09
36 0.13
37 0.16
38 0.16
39 0.18
40 0.19
41 0.19
42 0.2
43 0.2
44 0.17
45 0.15
46 0.19
47 0.18
48 0.23
49 0.24
50 0.24
51 0.27
52 0.25
53 0.25
54 0.27
55 0.27
56 0.25
57 0.27
58 0.27
59 0.28
60 0.28
61 0.26
62 0.21
63 0.2
64 0.2
65 0.2
66 0.18
67 0.14
68 0.16
69 0.23
70 0.31
71 0.39
72 0.47
73 0.54
74 0.61
75 0.66
76 0.7
77 0.64
78 0.58
79 0.52
80 0.47
81 0.43
82 0.36
83 0.32
84 0.29
85 0.29
86 0.26
87 0.25
88 0.21
89 0.19
90 0.24
91 0.35
92 0.43
93 0.52
94 0.62
95 0.71
96 0.8
97 0.86
98 0.89
99 0.88
100 0.86
101 0.83
102 0.79
103 0.73
104 0.64
105 0.63
106 0.59
107 0.5
108 0.46
109 0.41
110 0.38
111 0.41
112 0.48
113 0.5
114 0.55
115 0.63
116 0.7
117 0.76
118 0.84
119 0.83
120 0.84
121 0.82
122 0.75
123 0.74
124 0.67
125 0.66
126 0.57
127 0.54
128 0.46
129 0.38
130 0.34
131 0.27
132 0.23
133 0.14
134 0.15
135 0.12
136 0.15
137 0.18
138 0.2
139 0.2
140 0.19
141 0.19
142 0.19
143 0.18
144 0.14
145 0.11
146 0.09
147 0.09