Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2LND3

Protein Details
Accession A0A1Y2LND3    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
23-53EATPKSSAGIRKKQQEKKNKKEPTIEPKVQPHydrophilic
110-137AAAPPPPRKDPKPKPYPRKRDRDVHTDSBasic
NLS Segment(s)
PositionSequence
28-45SSAGIRKKQQEKKNKKEP
67-75LAKAKPSPR
112-129APPPPRKDPKPKPYPRKR
Subcellular Location(s) mito 17, nucl 5.5, cyto_nucl 5.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029058  AB_hydrolase  
IPR046879  KANL3/Tex30_Abhydrolase  
IPR026555  NSL3/Tex30  
Pfam View protein in Pfam  
PF20408  Abhydrolase_11  
Amino Acid Sequences MASARSTRSSTQSQTAHSRSKLEATPKSSAGIRKKQQEKKNKKEPTIEPKVQPGPTLAPVQAVLRRLAKAKPSPRTRDRGVHTDPESKPYGKAAGSGSASETARPNTAAAAAPPPPRKDPKPKPYPRKRDRDVHTDSESEPYSEDADSDFDSDSNSERYTELAPEAPPKREFTISSPLVKAPIVCHHYDLPPSPSKRAQLPFLFTHGAGGTLSAPAVVNFCTGFASASAKKPLCAFQGNSNLASRVKGFEAVLTHWRDVELIDEPAEPWGTGKERPVFGGRSMGARAAVVAATRLCSTPVRDGKVERVKLVLVSYPLQGPKEVRDQILYELPDRFEVMFIVGDRDEMCPLTLLEDVRAKMRAWSRVVVVKGAGHGMDSGSEVRTREVGEETGRVAARWVNGEMEGDEGGVVYIGSED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.58
3 0.6
4 0.55
5 0.55
6 0.48
7 0.51
8 0.51
9 0.5
10 0.51
11 0.49
12 0.52
13 0.48
14 0.49
15 0.47
16 0.5
17 0.5
18 0.53
19 0.55
20 0.6
21 0.7
22 0.77
23 0.82
24 0.85
25 0.87
26 0.87
27 0.9
28 0.9
29 0.87
30 0.87
31 0.88
32 0.87
33 0.86
34 0.83
35 0.75
36 0.74
37 0.73
38 0.64
39 0.55
40 0.47
41 0.41
42 0.37
43 0.36
44 0.28
45 0.22
46 0.22
47 0.24
48 0.24
49 0.22
50 0.21
51 0.21
52 0.23
53 0.25
54 0.28
55 0.33
56 0.39
57 0.46
58 0.53
59 0.6
60 0.68
61 0.73
62 0.77
63 0.76
64 0.75
65 0.73
66 0.72
67 0.67
68 0.66
69 0.63
70 0.64
71 0.59
72 0.55
73 0.52
74 0.44
75 0.39
76 0.33
77 0.32
78 0.22
79 0.25
80 0.21
81 0.22
82 0.22
83 0.21
84 0.21
85 0.21
86 0.21
87 0.2
88 0.2
89 0.16
90 0.17
91 0.17
92 0.15
93 0.12
94 0.14
95 0.12
96 0.11
97 0.14
98 0.17
99 0.23
100 0.28
101 0.3
102 0.34
103 0.4
104 0.47
105 0.54
106 0.61
107 0.65
108 0.72
109 0.8
110 0.85
111 0.9
112 0.94
113 0.93
114 0.92
115 0.89
116 0.87
117 0.83
118 0.81
119 0.77
120 0.72
121 0.66
122 0.57
123 0.51
124 0.45
125 0.39
126 0.29
127 0.22
128 0.16
129 0.14
130 0.12
131 0.11
132 0.08
133 0.08
134 0.08
135 0.09
136 0.09
137 0.07
138 0.08
139 0.08
140 0.09
141 0.09
142 0.09
143 0.09
144 0.09
145 0.1
146 0.11
147 0.12
148 0.11
149 0.11
150 0.12
151 0.18
152 0.21
153 0.23
154 0.23
155 0.25
156 0.26
157 0.26
158 0.27
159 0.24
160 0.31
161 0.3
162 0.31
163 0.3
164 0.27
165 0.27
166 0.25
167 0.21
168 0.13
169 0.17
170 0.18
171 0.17
172 0.19
173 0.2
174 0.21
175 0.22
176 0.23
177 0.21
178 0.24
179 0.25
180 0.27
181 0.28
182 0.28
183 0.33
184 0.33
185 0.34
186 0.3
187 0.33
188 0.31
189 0.31
190 0.3
191 0.24
192 0.22
193 0.16
194 0.14
195 0.1
196 0.09
197 0.06
198 0.05
199 0.05
200 0.04
201 0.04
202 0.04
203 0.04
204 0.04
205 0.04
206 0.04
207 0.05
208 0.05
209 0.05
210 0.05
211 0.05
212 0.09
213 0.11
214 0.13
215 0.18
216 0.18
217 0.19
218 0.2
219 0.22
220 0.21
221 0.23
222 0.22
223 0.24
224 0.33
225 0.34
226 0.34
227 0.32
228 0.29
229 0.26
230 0.25
231 0.19
232 0.12
233 0.11
234 0.11
235 0.1
236 0.1
237 0.12
238 0.13
239 0.18
240 0.19
241 0.19
242 0.17
243 0.17
244 0.16
245 0.14
246 0.14
247 0.1
248 0.08
249 0.09
250 0.09
251 0.09
252 0.1
253 0.1
254 0.08
255 0.06
256 0.08
257 0.09
258 0.11
259 0.15
260 0.19
261 0.19
262 0.22
263 0.25
264 0.25
265 0.23
266 0.27
267 0.23
268 0.21
269 0.21
270 0.19
271 0.16
272 0.14
273 0.13
274 0.08
275 0.08
276 0.06
277 0.06
278 0.06
279 0.07
280 0.08
281 0.08
282 0.09
283 0.1
284 0.13
285 0.21
286 0.27
287 0.29
288 0.31
289 0.33
290 0.41
291 0.49
292 0.48
293 0.4
294 0.36
295 0.32
296 0.31
297 0.3
298 0.23
299 0.16
300 0.16
301 0.16
302 0.18
303 0.19
304 0.19
305 0.19
306 0.18
307 0.2
308 0.27
309 0.28
310 0.26
311 0.26
312 0.27
313 0.29
314 0.33
315 0.3
316 0.24
317 0.23
318 0.23
319 0.21
320 0.21
321 0.18
322 0.13
323 0.12
324 0.11
325 0.1
326 0.1
327 0.12
328 0.1
329 0.11
330 0.11
331 0.12
332 0.12
333 0.11
334 0.11
335 0.09
336 0.09
337 0.11
338 0.12
339 0.11
340 0.14
341 0.17
342 0.18
343 0.19
344 0.21
345 0.2
346 0.24
347 0.29
348 0.33
349 0.33
350 0.35
351 0.37
352 0.41
353 0.42
354 0.37
355 0.33
356 0.27
357 0.24
358 0.23
359 0.19
360 0.13
361 0.12
362 0.11
363 0.1
364 0.1
365 0.1
366 0.1
367 0.12
368 0.13
369 0.14
370 0.15
371 0.16
372 0.16
373 0.18
374 0.19
375 0.2
376 0.21
377 0.21
378 0.24
379 0.23
380 0.21
381 0.2
382 0.2
383 0.19
384 0.21
385 0.21
386 0.18
387 0.18
388 0.19
389 0.18
390 0.17
391 0.15
392 0.12
393 0.1
394 0.08
395 0.08
396 0.06
397 0.05