Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2MCC1

Protein Details
Accession A0A1Y2MCC1   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
57-77DVFRRCWQKHGNDKRTDSKDVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10, cyto_nucl 8.5, mito 7, cyto 5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR039870  Coa4-like  
Gene Ontology GO:0005758  C:mitochondrial intermembrane space  
GO:0033617  P:mitochondrial cytochrome c oxidase assembly  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MSKDTKAQATAAQVTADDEPDEWDKRIFSTGCADENAKLTDCYYEKKDWRACKAEMDVFRRCWQKHGNDKRTDSKDV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.17
4 0.12
5 0.09
6 0.11
7 0.14
8 0.16
9 0.15
10 0.15
11 0.14
12 0.15
13 0.19
14 0.16
15 0.14
16 0.18
17 0.19
18 0.19
19 0.2
20 0.2
21 0.17
22 0.19
23 0.18
24 0.13
25 0.12
26 0.1
27 0.12
28 0.12
29 0.14
30 0.16
31 0.21
32 0.23
33 0.31
34 0.37
35 0.4
36 0.46
37 0.49
38 0.46
39 0.46
40 0.48
41 0.48
42 0.48
43 0.48
44 0.46
45 0.44
46 0.49
47 0.51
48 0.46
49 0.46
50 0.47
51 0.52
52 0.58
53 0.66
54 0.7
55 0.72
56 0.78
57 0.82