Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1UFT2

Protein Details
Accession A0A1Y1UFT2    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
44-85KGGNTYQPSQRKRKRKHGFLSRIKTAKGRKILTRRMVKGRKFBasic
NLS Segment(s)
PositionSequence
54-84RKRKRKHGFLSRIKTAKGRKILTRRMVKGRK
Subcellular Location(s) mito 19.5, mito_nucl 13.666, nucl 6.5, cyto_nucl 4.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences STLRASLIPRITSLLRPTLSSPIPSALLPHNSPLDLGQVRFGSKGGNTYQPSQRKRKRKHGFLSRIKTAKGRKILTRRMVKGRKFLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.25
3 0.26
4 0.27
5 0.29
6 0.29
7 0.27
8 0.25
9 0.2
10 0.21
11 0.19
12 0.19
13 0.17
14 0.2
15 0.19
16 0.2
17 0.18
18 0.17
19 0.17
20 0.15
21 0.17
22 0.14
23 0.13
24 0.13
25 0.13
26 0.14
27 0.14
28 0.13
29 0.09
30 0.08
31 0.11
32 0.1
33 0.16
34 0.18
35 0.21
36 0.29
37 0.37
38 0.43
39 0.51
40 0.58
41 0.62
42 0.7
43 0.77
44 0.81
45 0.83
46 0.87
47 0.88
48 0.9
49 0.9
50 0.89
51 0.86
52 0.79
53 0.71
54 0.67
55 0.63
56 0.6
57 0.58
58 0.55
59 0.56
60 0.62
61 0.7
62 0.73
63 0.76
64 0.75
65 0.77
66 0.82
67 0.78
68 0.78