Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1UI33

Protein Details
Accession A0A1Y1UI33   
Localization Confidence High
Confidence Score 17.7
NoLS Segment(s)
PositionSequenceProtein Nature
89-119DIKPKRKKAASKSTSTPKRKRTKAENEVDEAHydrophilic
139-187GGSESKPKVKTPKKSRIAKDEPEFDSDGKEIIKKKRKPKVYPKIEYDIPHydrophilic
524-547GLRTNGRKSSVKKKTKPTGDVDSEHydrophilic
NLS Segment(s)
PositionSequence
91-111KPKRKKAASKSTSTPKRKRTK
144-158KPKVKTPKKSRIAKD
166-177GKEIIKKKRKPK
530-537RKSSVKKK
Subcellular Location(s) mito 20.5, cyto_mito 12.833, mito_nucl 12.666, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004601  UvdE  
IPR036237  Xyl_isomerase-like_sf  
Gene Ontology GO:0004519  F:endonuclease activity  
GO:0006289  P:nucleotide-excision repair  
GO:0009411  P:response to UV  
Pfam View protein in Pfam  
PF03851  UvdE  
Amino Acid Sequences MSLRAGIRIALARPLVRIVVVQPIMARRTRASVAAASAAAPSNNVAAAPPPTTTTMIHALEHIPPAPIIPLPHDELTPLSSEAEEPVEDIKPKRKKAASKSTSTPKRKRTKAENEVDEATTPAPKAVKKEADASPDTSGGSESKPKVKTPKKSRIAKDEPEFDSDGKEIIKKKRKPKVYPKIEYDIPPVERKETTFRGRLGYACLNTVLRSIKPDSIFCSRTCRIASIEEEGMELPKGLAMMNVKDLKVMIEWNEQNGIRFLRMSSEMFPFASHEKYGYDLSFADAELKEAGELAKKYGHRLTMHPGQFTQLGSPKEAVIKASVRELDYQCEIMDRMGIDKDGVMIIHMGGVYGDKESTLARFKENFTTRLSDSVKARLVLENDEVGTRVRPRDSDGQICYNVDDLLPISRELSIPIIFDYHHDWINPSAQPPGELIPQIKEIWDRRGIRMKQHLSEPRPGAETVMEKRAHADRCKVLPPDLPDDVDLMIEAKDKEQAVFELYRIYGLHEPIHDNLRPPNPAPGLRTNGRKSSVKKKTKPTGDVDSEGNSVVLTDDEKEGDGGIGDEGEIGTREVKPNV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.21
3 0.18
4 0.18
5 0.15
6 0.2
7 0.2
8 0.19
9 0.2
10 0.24
11 0.28
12 0.29
13 0.3
14 0.23
15 0.28
16 0.3
17 0.29
18 0.28
19 0.27
20 0.27
21 0.27
22 0.25
23 0.2
24 0.19
25 0.18
26 0.14
27 0.12
28 0.11
29 0.09
30 0.09
31 0.08
32 0.07
33 0.09
34 0.11
35 0.12
36 0.12
37 0.14
38 0.16
39 0.18
40 0.19
41 0.2
42 0.25
43 0.25
44 0.25
45 0.24
46 0.24
47 0.24
48 0.25
49 0.22
50 0.16
51 0.14
52 0.14
53 0.14
54 0.13
55 0.12
56 0.14
57 0.17
58 0.2
59 0.21
60 0.21
61 0.2
62 0.2
63 0.2
64 0.19
65 0.16
66 0.12
67 0.11
68 0.12
69 0.12
70 0.12
71 0.11
72 0.1
73 0.11
74 0.13
75 0.16
76 0.19
77 0.27
78 0.34
79 0.39
80 0.47
81 0.52
82 0.6
83 0.67
84 0.75
85 0.73
86 0.73
87 0.77
88 0.79
89 0.82
90 0.83
91 0.82
92 0.81
93 0.84
94 0.84
95 0.85
96 0.85
97 0.86
98 0.86
99 0.87
100 0.83
101 0.77
102 0.71
103 0.63
104 0.52
105 0.41
106 0.31
107 0.23
108 0.17
109 0.13
110 0.13
111 0.14
112 0.18
113 0.25
114 0.3
115 0.31
116 0.37
117 0.39
118 0.43
119 0.44
120 0.42
121 0.36
122 0.31
123 0.29
124 0.23
125 0.2
126 0.14
127 0.14
128 0.18
129 0.19
130 0.26
131 0.28
132 0.32
133 0.41
134 0.49
135 0.58
136 0.62
137 0.71
138 0.73
139 0.81
140 0.84
141 0.84
142 0.84
143 0.82
144 0.78
145 0.75
146 0.67
147 0.62
148 0.56
149 0.45
150 0.38
151 0.29
152 0.24
153 0.17
154 0.18
155 0.21
156 0.29
157 0.39
158 0.45
159 0.55
160 0.63
161 0.72
162 0.79
163 0.84
164 0.85
165 0.86
166 0.87
167 0.83
168 0.81
169 0.74
170 0.66
171 0.59
172 0.54
173 0.45
174 0.41
175 0.35
176 0.32
177 0.29
178 0.28
179 0.3
180 0.31
181 0.34
182 0.35
183 0.35
184 0.35
185 0.36
186 0.34
187 0.33
188 0.31
189 0.26
190 0.22
191 0.22
192 0.19
193 0.18
194 0.2
195 0.16
196 0.12
197 0.15
198 0.16
199 0.19
200 0.2
201 0.21
202 0.23
203 0.28
204 0.29
205 0.27
206 0.33
207 0.29
208 0.32
209 0.31
210 0.28
211 0.24
212 0.25
213 0.26
214 0.22
215 0.22
216 0.18
217 0.18
218 0.16
219 0.14
220 0.11
221 0.09
222 0.05
223 0.04
224 0.04
225 0.04
226 0.05
227 0.06
228 0.07
229 0.11
230 0.13
231 0.13
232 0.13
233 0.13
234 0.12
235 0.11
236 0.12
237 0.09
238 0.14
239 0.14
240 0.15
241 0.18
242 0.17
243 0.17
244 0.18
245 0.17
246 0.11
247 0.11
248 0.1
249 0.09
250 0.12
251 0.12
252 0.13
253 0.14
254 0.14
255 0.14
256 0.14
257 0.13
258 0.13
259 0.13
260 0.11
261 0.09
262 0.09
263 0.11
264 0.12
265 0.1
266 0.09
267 0.08
268 0.09
269 0.09
270 0.09
271 0.09
272 0.08
273 0.08
274 0.07
275 0.07
276 0.06
277 0.06
278 0.06
279 0.06
280 0.07
281 0.07
282 0.11
283 0.11
284 0.14
285 0.16
286 0.2
287 0.19
288 0.21
289 0.27
290 0.32
291 0.33
292 0.32
293 0.29
294 0.27
295 0.26
296 0.24
297 0.2
298 0.17
299 0.16
300 0.16
301 0.16
302 0.15
303 0.16
304 0.16
305 0.14
306 0.12
307 0.12
308 0.12
309 0.14
310 0.15
311 0.14
312 0.18
313 0.18
314 0.18
315 0.17
316 0.17
317 0.15
318 0.14
319 0.13
320 0.09
321 0.09
322 0.07
323 0.07
324 0.07
325 0.07
326 0.06
327 0.06
328 0.06
329 0.05
330 0.05
331 0.04
332 0.04
333 0.04
334 0.04
335 0.04
336 0.04
337 0.03
338 0.04
339 0.04
340 0.04
341 0.04
342 0.03
343 0.04
344 0.05
345 0.07
346 0.11
347 0.12
348 0.15
349 0.17
350 0.19
351 0.28
352 0.31
353 0.31
354 0.29
355 0.33
356 0.3
357 0.35
358 0.36
359 0.31
360 0.29
361 0.32
362 0.31
363 0.28
364 0.28
365 0.24
366 0.23
367 0.21
368 0.21
369 0.16
370 0.15
371 0.14
372 0.14
373 0.11
374 0.12
375 0.12
376 0.13
377 0.14
378 0.14
379 0.18
380 0.27
381 0.31
382 0.35
383 0.36
384 0.38
385 0.39
386 0.38
387 0.34
388 0.26
389 0.21
390 0.15
391 0.11
392 0.07
393 0.08
394 0.09
395 0.08
396 0.08
397 0.09
398 0.09
399 0.1
400 0.12
401 0.1
402 0.1
403 0.1
404 0.1
405 0.09
406 0.11
407 0.14
408 0.14
409 0.14
410 0.14
411 0.15
412 0.16
413 0.21
414 0.2
415 0.17
416 0.18
417 0.17
418 0.17
419 0.17
420 0.18
421 0.16
422 0.16
423 0.16
424 0.15
425 0.18
426 0.17
427 0.17
428 0.21
429 0.21
430 0.25
431 0.33
432 0.33
433 0.37
434 0.47
435 0.48
436 0.51
437 0.59
438 0.59
439 0.55
440 0.61
441 0.65
442 0.59
443 0.65
444 0.59
445 0.51
446 0.48
447 0.44
448 0.36
449 0.29
450 0.3
451 0.25
452 0.3
453 0.28
454 0.26
455 0.29
456 0.35
457 0.38
458 0.37
459 0.41
460 0.4
461 0.44
462 0.51
463 0.5
464 0.46
465 0.45
466 0.46
467 0.45
468 0.4
469 0.37
470 0.31
471 0.29
472 0.26
473 0.21
474 0.16
475 0.1
476 0.08
477 0.1
478 0.1
479 0.09
480 0.12
481 0.13
482 0.13
483 0.14
484 0.15
485 0.16
486 0.17
487 0.17
488 0.17
489 0.16
490 0.17
491 0.16
492 0.19
493 0.18
494 0.19
495 0.21
496 0.2
497 0.23
498 0.24
499 0.3
500 0.27
501 0.26
502 0.32
503 0.35
504 0.37
505 0.35
506 0.41
507 0.4
508 0.43
509 0.46
510 0.46
511 0.48
512 0.5
513 0.58
514 0.56
515 0.57
516 0.59
517 0.61
518 0.6
519 0.64
520 0.69
521 0.7
522 0.73
523 0.78
524 0.83
525 0.85
526 0.87
527 0.83
528 0.82
529 0.77
530 0.72
531 0.63
532 0.56
533 0.47
534 0.39
535 0.32
536 0.21
537 0.14
538 0.12
539 0.1
540 0.07
541 0.08
542 0.09
543 0.1
544 0.11
545 0.11
546 0.11
547 0.1
548 0.1
549 0.08
550 0.07
551 0.06
552 0.06
553 0.06
554 0.06
555 0.06
556 0.06
557 0.07
558 0.09
559 0.11