Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9P8N7

Protein Details
Accession G9P8N7    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
17-41DDCGKSGYARRKKEKRARLTRYAFYHydrophilic
NLS Segment(s)
PositionSequence
26-34RRKKEKRAR
Subcellular Location(s) nucl 18.5, cyto_nucl 15, cyto 8.5
Family & Domain DBs
Amino Acid Sequences MDVIQTSDSVGKSGSDDDCGKSGYARRKKEKRARLTRYAFYICLVLCISTRCCKEDRQEQCMHHQHNSSIGRGFY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.15
3 0.16
4 0.17
5 0.18
6 0.19
7 0.17
8 0.17
9 0.22
10 0.28
11 0.35
12 0.42
13 0.52
14 0.6
15 0.71
16 0.79
17 0.83
18 0.84
19 0.86
20 0.85
21 0.85
22 0.82
23 0.73
24 0.68
25 0.6
26 0.49
27 0.38
28 0.32
29 0.22
30 0.17
31 0.14
32 0.1
33 0.08
34 0.1
35 0.12
36 0.16
37 0.18
38 0.19
39 0.21
40 0.24
41 0.32
42 0.4
43 0.45
44 0.47
45 0.53
46 0.53
47 0.62
48 0.67
49 0.63
50 0.59
51 0.54
52 0.47
53 0.49
54 0.49
55 0.42