Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1UAW2

Protein Details
Accession A0A1Y1UAW2    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
36-73WVSARMSPKEKRKRERGWFTKRERAKGKKRVTPMTRFLHydrophilic
NLS Segment(s)
PositionSequence
42-65SPKEKRKRERGWFTKRERAKGKKR
Subcellular Location(s) nucl 13, mito 11, cyto 1, plas 1, E.R. 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MIRIPLLFDKEQNSNTLLPFSLAFLISVLSSAFPPWVSARMSPKEKRKRERGWFTKRERAKGKKRVTPMTRFLQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.23
4 0.19
5 0.14
6 0.13
7 0.12
8 0.11
9 0.09
10 0.09
11 0.07
12 0.07
13 0.06
14 0.06
15 0.05
16 0.04
17 0.04
18 0.04
19 0.05
20 0.04
21 0.05
22 0.06
23 0.08
24 0.09
25 0.11
26 0.17
27 0.23
28 0.3
29 0.35
30 0.45
31 0.54
32 0.62
33 0.69
34 0.73
35 0.78
36 0.82
37 0.87
38 0.87
39 0.87
40 0.88
41 0.87
42 0.87
43 0.83
44 0.81
45 0.8
46 0.8
47 0.8
48 0.81
49 0.83
50 0.81
51 0.83
52 0.85
53 0.83
54 0.81