Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1UKJ9

Protein Details
Accession A0A1Y1UKJ9   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
72-92RVKLSRGRKLHWRKMGWKWNAHydrophilic
NLS Segment(s)
PositionSequence
78-80GRK
Subcellular Location(s) cyto 12.5, mito 9, cyto_pero 7.5, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR014048  MethylDNA_cys_MeTrfase_DNA-bd  
IPR036217  MethylDNA_cys_MeTrfase_DNAb  
IPR036388  WH-like_DNA-bd_sf  
Gene Ontology GO:0003824  F:catalytic activity  
GO:0006281  P:DNA repair  
Pfam View protein in Pfam  
PF01035  DNA_binding_1  
CDD cd06445  ATase  
Amino Acid Sequences MGSIADLHAKTYEIVRMIPPGHVTSYGHIAKLAGYPRYSRHVGNALRDLPAGSTVPCVSYPRLVRFLPVAMRVKLSRGRKLHWRKMGWKWNA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.17
4 0.17
5 0.18
6 0.19
7 0.17
8 0.17
9 0.17
10 0.17
11 0.15
12 0.22
13 0.21
14 0.19
15 0.17
16 0.16
17 0.15
18 0.18
19 0.19
20 0.14
21 0.14
22 0.15
23 0.18
24 0.23
25 0.24
26 0.21
27 0.21
28 0.27
29 0.28
30 0.3
31 0.32
32 0.28
33 0.26
34 0.26
35 0.23
36 0.15
37 0.14
38 0.11
39 0.07
40 0.07
41 0.07
42 0.08
43 0.08
44 0.1
45 0.1
46 0.15
47 0.19
48 0.22
49 0.26
50 0.25
51 0.26
52 0.26
53 0.28
54 0.25
55 0.28
56 0.29
57 0.25
58 0.29
59 0.28
60 0.31
61 0.36
62 0.39
63 0.41
64 0.41
65 0.46
66 0.53
67 0.64
68 0.69
69 0.72
70 0.74
71 0.74
72 0.8