Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1UIS2

Protein Details
Accession A0A1Y1UIS2   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
2-47SPSHIPIVKKRTKHFKRHQSDRYHGVKESWRKPKGIDNRVRRRFKGBasic
NLS Segment(s)
PositionSequence
10-51KKRTKHFKRHQSDRYHGVKESWRKPKGIDNRVRRRFKGQLPM
Subcellular Location(s) nucl 17.5, mito_nucl 12.5, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MSPSHIPIVKKRTKHFKRHQSDRYHGVKESWRKPKGIDNRVRRRFKGQLPMPKIGYGSNKKTRHMLPSGHRELLVHNLSDLELLLMHSNRYAAVIAHGVSSKKRIELIQRAKVLGVKVTNSAGKLRTEEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.83
3 0.83
4 0.87
5 0.91
6 0.91
7 0.89
8 0.87
9 0.85
10 0.81
11 0.74
12 0.64
13 0.57
14 0.56
15 0.56
16 0.58
17 0.59
18 0.54
19 0.52
20 0.53
21 0.58
22 0.6
23 0.62
24 0.62
25 0.63
26 0.71
27 0.8
28 0.84
29 0.77
30 0.74
31 0.71
32 0.67
33 0.67
34 0.64
35 0.64
36 0.63
37 0.65
38 0.59
39 0.52
40 0.46
41 0.37
42 0.37
43 0.33
44 0.35
45 0.4
46 0.41
47 0.41
48 0.45
49 0.45
50 0.42
51 0.41
52 0.39
53 0.36
54 0.43
55 0.46
56 0.42
57 0.4
58 0.35
59 0.31
60 0.32
61 0.26
62 0.17
63 0.13
64 0.12
65 0.12
66 0.12
67 0.11
68 0.05
69 0.04
70 0.04
71 0.06
72 0.06
73 0.06
74 0.06
75 0.06
76 0.06
77 0.07
78 0.07
79 0.05
80 0.07
81 0.08
82 0.08
83 0.09
84 0.11
85 0.11
86 0.12
87 0.16
88 0.15
89 0.15
90 0.17
91 0.19
92 0.27
93 0.37
94 0.46
95 0.5
96 0.52
97 0.52
98 0.5
99 0.5
100 0.42
101 0.36
102 0.29
103 0.22
104 0.21
105 0.24
106 0.25
107 0.24
108 0.26
109 0.24
110 0.24