Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1UBH6

Protein Details
Accession A0A1Y1UBH6    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
73-94LAKLHGTKKRRGTRPNRHQDSSBasic
NLS Segment(s)
PositionSequence
79-86TKKRRGTR
Subcellular Location(s) cyto 9.5, cyto_nucl 9.5, nucl 8.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR001266  Ribosomal_S19e  
IPR018277  Ribosomal_S19e_CS  
IPR036388  WH-like_DNA-bd_sf  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01090  Ribosomal_S19e  
PROSITE View protein in PROSITE  
PS00628  RIBOSOMAL_S19E  
Amino Acid Sequences MPGVRDVSAEAFIKAYSSHLKRSGKLDIPTWVDTVKTGCQKELAPYDPDWYYVRAAAVARHIYLRKSVGVGALAKLHGTKKRRGTRPNRHQDSSTGVQRSVVQGLEKIGVLELAQDGGRRISQDGMRDLDRIATAVLEQERAEEDEEEEDEDEDEDEDEAEEEADDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.14
3 0.19
4 0.21
5 0.27
6 0.35
7 0.39
8 0.42
9 0.46
10 0.52
11 0.5
12 0.5
13 0.47
14 0.45
15 0.46
16 0.44
17 0.4
18 0.32
19 0.25
20 0.23
21 0.23
22 0.22
23 0.24
24 0.23
25 0.22
26 0.24
27 0.25
28 0.29
29 0.32
30 0.3
31 0.26
32 0.26
33 0.28
34 0.26
35 0.28
36 0.24
37 0.2
38 0.17
39 0.15
40 0.14
41 0.12
42 0.13
43 0.11
44 0.14
45 0.13
46 0.13
47 0.15
48 0.16
49 0.15
50 0.17
51 0.17
52 0.14
53 0.14
54 0.14
55 0.11
56 0.12
57 0.12
58 0.11
59 0.1
60 0.09
61 0.09
62 0.09
63 0.11
64 0.15
65 0.18
66 0.23
67 0.32
68 0.42
69 0.49
70 0.58
71 0.67
72 0.73
73 0.81
74 0.86
75 0.83
76 0.76
77 0.69
78 0.61
79 0.57
80 0.51
81 0.45
82 0.35
83 0.28
84 0.27
85 0.26
86 0.26
87 0.2
88 0.15
89 0.1
90 0.09
91 0.1
92 0.1
93 0.09
94 0.08
95 0.07
96 0.06
97 0.05
98 0.05
99 0.04
100 0.04
101 0.05
102 0.05
103 0.06
104 0.07
105 0.07
106 0.08
107 0.09
108 0.12
109 0.14
110 0.18
111 0.21
112 0.23
113 0.24
114 0.23
115 0.23
116 0.2
117 0.18
118 0.15
119 0.11
120 0.08
121 0.07
122 0.1
123 0.11
124 0.1
125 0.1
126 0.11
127 0.12
128 0.13
129 0.15
130 0.12
131 0.12
132 0.13
133 0.14
134 0.14
135 0.13
136 0.12
137 0.11
138 0.11
139 0.1
140 0.09
141 0.08
142 0.07
143 0.07
144 0.07
145 0.07
146 0.07
147 0.06