Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1UQT4

Protein Details
Accession A0A1Y1UQT4    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
5-25RKSDSVHTRHQKPYDKPHSRPBasic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto_nucl 10.5, mito 5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR017930  Myb_dom  
IPR001005  SANT/Myb  
Pfam View protein in Pfam  
PF13921  Myb_DNA-bind_6  
PROSITE View protein in PROSITE  
PS51294  HTH_MYB  
PS50090  MYB_LIKE  
CDD cd00167  SANT  
Amino Acid Sequences MQVIRKSDSVHTRHQKPYDKPHSRPGVTAARSDDEKISASSAPGTYDKNLLAKLVLETAKLNARDWDEISSTVGQTLSKNKDLWRKVIKTQLIAGKEWSKSTSPSWTNQQKIALVNYILDKTSVNWDQVARSFPGKSPIQVKDVWRKVLLPKIRRGDPVN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.74
3 0.73
4 0.8
5 0.8
6 0.8
7 0.77
8 0.78
9 0.8
10 0.72
11 0.65
12 0.6
13 0.59
14 0.51
15 0.5
16 0.43
17 0.36
18 0.36
19 0.36
20 0.3
21 0.22
22 0.21
23 0.18
24 0.17
25 0.14
26 0.13
27 0.13
28 0.12
29 0.13
30 0.13
31 0.14
32 0.14
33 0.15
34 0.16
35 0.16
36 0.16
37 0.14
38 0.12
39 0.11
40 0.1
41 0.12
42 0.11
43 0.1
44 0.1
45 0.12
46 0.16
47 0.16
48 0.16
49 0.15
50 0.17
51 0.17
52 0.18
53 0.18
54 0.15
55 0.14
56 0.16
57 0.14
58 0.12
59 0.11
60 0.1
61 0.08
62 0.08
63 0.14
64 0.16
65 0.17
66 0.19
67 0.22
68 0.3
69 0.31
70 0.37
71 0.39
72 0.39
73 0.41
74 0.47
75 0.46
76 0.39
77 0.42
78 0.39
79 0.33
80 0.3
81 0.29
82 0.25
83 0.24
84 0.23
85 0.21
86 0.17
87 0.18
88 0.19
89 0.25
90 0.23
91 0.26
92 0.35
93 0.41
94 0.42
95 0.43
96 0.43
97 0.38
98 0.37
99 0.35
100 0.28
101 0.2
102 0.19
103 0.18
104 0.17
105 0.14
106 0.12
107 0.11
108 0.1
109 0.17
110 0.17
111 0.16
112 0.17
113 0.18
114 0.2
115 0.23
116 0.24
117 0.2
118 0.2
119 0.21
120 0.21
121 0.27
122 0.26
123 0.28
124 0.33
125 0.34
126 0.35
127 0.38
128 0.43
129 0.47
130 0.52
131 0.52
132 0.46
133 0.46
134 0.48
135 0.53
136 0.56
137 0.52
138 0.56
139 0.6
140 0.63