Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1UDZ7

Protein Details
Accession A0A1Y1UDZ7    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
45-73DDNLRRKPRSWQLRRMGQLRRTRRQRRSNHydrophilic
NLS Segment(s)
PositionSequence
9-73RARAKNLAKSQPGANKKSGDPVKRKEADMEAMRKKADDNLRRKPRSWQLRRMGQLRRTRRQRRSN
Subcellular Location(s) nucl 20, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007513  SERF-like_N  
Pfam View protein in Pfam  
PF04419  4F5  
Amino Acid Sequences MTRGDQRERARAKNLAKSQPGANKKSGDPVKRKEADMEAMRKKADDNLRRKPRSWQLRRMGQLRRTRRQRRSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.64
3 0.61
4 0.58
5 0.58
6 0.59
7 0.6
8 0.53
9 0.49
10 0.44
11 0.41
12 0.48
13 0.48
14 0.47
15 0.47
16 0.49
17 0.55
18 0.54
19 0.54
20 0.47
21 0.43
22 0.41
23 0.37
24 0.39
25 0.33
26 0.33
27 0.32
28 0.3
29 0.28
30 0.28
31 0.33
32 0.35
33 0.39
34 0.49
35 0.6
36 0.63
37 0.64
38 0.67
39 0.68
40 0.7
41 0.71
42 0.7
43 0.69
44 0.75
45 0.81
46 0.8
47 0.79
48 0.76
49 0.77
50 0.77
51 0.78
52 0.79
53 0.83