Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1U9U8

Protein Details
Accession A0A1Y1U9U8    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
16-35GPSRRSSHIQRAQRERPPGRBasic
NLS Segment(s)
PositionSequence
26-136RAQRERPPGRTERVGARSATPAYSSRGRNRKGYKGKAGTAADGAKAGSEHRKKRSSAFNVGPAHAPKNAYLGKAKKIKADLIMKSKIKREYAKVLKAEGMESDRLKPRGRK
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 4
Family & Domain DBs
Amino Acid Sequences MARGSDPFFSTAGEAGPSRRSSHIQRAQRERPPGRTERVGARSATPAYSSRGRNRKGYKGKAGTAADGAKAGSEHRKKRSSAFNVGPAHAPKNAYLGKAKKIKADLIMKSKIKREYAKVLKAEGMESDRLKPRGRKGESQSTADPPKNPPVLPSQSPPLLPGSSPTLDEAAFPAPGRPSQRQRATQKPLADKTRALRPQDIGHPMPQTSLRELKKEAYSKFHRPANRSGATPTGAGVMGHGRRGGSQPNLGARMGVLLEKIKRDKAAAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.19
4 0.2
5 0.22
6 0.24
7 0.29
8 0.34
9 0.44
10 0.52
11 0.55
12 0.63
13 0.7
14 0.76
15 0.78
16 0.82
17 0.77
18 0.76
19 0.76
20 0.73
21 0.69
22 0.66
23 0.63
24 0.61
25 0.6
26 0.55
27 0.48
28 0.43
29 0.41
30 0.36
31 0.33
32 0.26
33 0.22
34 0.24
35 0.29
36 0.33
37 0.38
38 0.46
39 0.49
40 0.56
41 0.61
42 0.67
43 0.71
44 0.74
45 0.75
46 0.72
47 0.72
48 0.7
49 0.65
50 0.55
51 0.48
52 0.4
53 0.3
54 0.24
55 0.2
56 0.12
57 0.11
58 0.11
59 0.17
60 0.24
61 0.31
62 0.39
63 0.45
64 0.46
65 0.53
66 0.61
67 0.59
68 0.6
69 0.58
70 0.59
71 0.56
72 0.55
73 0.52
74 0.43
75 0.38
76 0.3
77 0.26
78 0.18
79 0.21
80 0.22
81 0.2
82 0.25
83 0.26
84 0.32
85 0.38
86 0.39
87 0.37
88 0.38
89 0.38
90 0.39
91 0.43
92 0.41
93 0.4
94 0.46
95 0.46
96 0.46
97 0.49
98 0.46
99 0.44
100 0.43
101 0.4
102 0.44
103 0.48
104 0.52
105 0.48
106 0.45
107 0.42
108 0.38
109 0.34
110 0.25
111 0.19
112 0.15
113 0.14
114 0.16
115 0.18
116 0.2
117 0.23
118 0.25
119 0.3
120 0.38
121 0.41
122 0.45
123 0.48
124 0.57
125 0.57
126 0.57
127 0.52
128 0.47
129 0.48
130 0.42
131 0.37
132 0.29
133 0.32
134 0.3
135 0.28
136 0.25
137 0.27
138 0.3
139 0.31
140 0.3
141 0.28
142 0.27
143 0.27
144 0.26
145 0.22
146 0.17
147 0.15
148 0.14
149 0.15
150 0.14
151 0.14
152 0.14
153 0.13
154 0.12
155 0.12
156 0.12
157 0.09
158 0.09
159 0.08
160 0.09
161 0.09
162 0.12
163 0.17
164 0.22
165 0.28
166 0.37
167 0.45
168 0.53
169 0.6
170 0.67
171 0.7
172 0.7
173 0.7
174 0.68
175 0.68
176 0.65
177 0.6
178 0.53
179 0.49
180 0.53
181 0.52
182 0.48
183 0.44
184 0.41
185 0.43
186 0.45
187 0.48
188 0.4
189 0.37
190 0.36
191 0.32
192 0.31
193 0.3
194 0.26
195 0.24
196 0.31
197 0.29
198 0.31
199 0.33
200 0.37
201 0.41
202 0.45
203 0.43
204 0.44
205 0.49
206 0.55
207 0.6
208 0.61
209 0.6
210 0.58
211 0.64
212 0.64
213 0.6
214 0.53
215 0.48
216 0.46
217 0.41
218 0.36
219 0.28
220 0.2
221 0.17
222 0.15
223 0.13
224 0.16
225 0.15
226 0.16
227 0.17
228 0.15
229 0.17
230 0.2
231 0.25
232 0.23
233 0.26
234 0.29
235 0.35
236 0.37
237 0.35
238 0.32
239 0.26
240 0.24
241 0.2
242 0.16
243 0.12
244 0.14
245 0.17
246 0.24
247 0.28
248 0.3
249 0.31