Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1UI66

Protein Details
Accession A0A1Y1UI66   
Localization Confidence Low
Confidence Score 5.5
NoLS Segment(s)
PositionSequenceProtein Nature
42-63FGERPPPPGQRRKKENWERLFHBasic
NLS Segment(s)
Subcellular Location(s) mito 20.5, cyto_mito 12, cyto 2.5, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR019329  NADH_UbQ_OxRdtase_ESSS_su  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
Pfam View protein in Pfam  
PF10183  ESSS  
Amino Acid Sequences MASLRPLSSLRTGLKAAPGVATVGRRHAGGGGGFNAPTGWIFGERPPPPGQRRKKENWERLFHWGMITPLVLLVAWKQLGPDTSMEPWARKEAEKRMSERGDLPKYTPTKENIVSYEEWDRREASRLSSQGKGGEGAH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.28
3 0.25
4 0.2
5 0.18
6 0.16
7 0.16
8 0.19
9 0.15
10 0.17
11 0.17
12 0.16
13 0.16
14 0.16
15 0.16
16 0.14
17 0.15
18 0.13
19 0.13
20 0.13
21 0.12
22 0.11
23 0.09
24 0.08
25 0.07
26 0.06
27 0.06
28 0.07
29 0.09
30 0.18
31 0.19
32 0.22
33 0.26
34 0.32
35 0.38
36 0.47
37 0.55
38 0.57
39 0.64
40 0.69
41 0.76
42 0.8
43 0.83
44 0.82
45 0.78
46 0.71
47 0.7
48 0.64
49 0.53
50 0.42
51 0.33
52 0.24
53 0.18
54 0.15
55 0.08
56 0.06
57 0.05
58 0.05
59 0.03
60 0.03
61 0.04
62 0.04
63 0.05
64 0.05
65 0.05
66 0.06
67 0.08
68 0.08
69 0.09
70 0.1
71 0.14
72 0.15
73 0.15
74 0.16
75 0.18
76 0.18
77 0.19
78 0.23
79 0.28
80 0.36
81 0.4
82 0.42
83 0.47
84 0.47
85 0.47
86 0.48
87 0.48
88 0.45
89 0.42
90 0.4
91 0.4
92 0.41
93 0.42
94 0.4
95 0.34
96 0.35
97 0.37
98 0.39
99 0.33
100 0.35
101 0.33
102 0.32
103 0.38
104 0.34
105 0.33
106 0.31
107 0.31
108 0.28
109 0.33
110 0.31
111 0.27
112 0.33
113 0.37
114 0.4
115 0.41
116 0.42
117 0.39
118 0.38