Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1UMH6

Protein Details
Accession A0A1Y1UMH6   
Localization Confidence High
Confidence Score 19.2
NoLS Segment(s)
PositionSequenceProtein Nature
8-37PGGKLKLKGEGEKKKKKKSHSSSDRAKVDABasic
NLS Segment(s)
PositionSequence
7-29RPGGKLKLKGEGEKKKKKKSHSS
74-83RKRREERALK
Subcellular Location(s) nucl 24, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MSDYAHRPGGKLKLKGEGEKKKKKKSHSSSDRAKVDAEISQKEKERERETQEVEERPTGRKMTDAERRFEEIQRKRREERALKNAKMSHKDRVQEFNQRLDSLSEHHDMPRIGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.59
3 0.63
4 0.64
5 0.66
6 0.72
7 0.79
8 0.8
9 0.83
10 0.85
11 0.86
12 0.85
13 0.86
14 0.86
15 0.86
16 0.86
17 0.89
18 0.82
19 0.71
20 0.62
21 0.51
22 0.41
23 0.35
24 0.28
25 0.22
26 0.22
27 0.25
28 0.27
29 0.29
30 0.33
31 0.36
32 0.38
33 0.4
34 0.43
35 0.47
36 0.46
37 0.49
38 0.48
39 0.43
40 0.4
41 0.37
42 0.32
43 0.27
44 0.26
45 0.21
46 0.17
47 0.17
48 0.17
49 0.21
50 0.3
51 0.31
52 0.32
53 0.34
54 0.38
55 0.38
56 0.4
57 0.43
58 0.42
59 0.49
60 0.55
61 0.59
62 0.58
63 0.63
64 0.69
65 0.69
66 0.69
67 0.71
68 0.71
69 0.68
70 0.71
71 0.69
72 0.66
73 0.65
74 0.59
75 0.57
76 0.53
77 0.56
78 0.54
79 0.56
80 0.54
81 0.56
82 0.56
83 0.55
84 0.52
85 0.47
86 0.44
87 0.38
88 0.35
89 0.27
90 0.29
91 0.23
92 0.21
93 0.22
94 0.25
95 0.23