Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1UR29

Protein Details
Accession A0A1Y1UR29    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
121-140MEPKKFGGRGARARRQKSYRBasic
NLS Segment(s)
PositionSequence
119-140RRMEPKKFGGRGARARRQKSYR
Subcellular Location(s) mito 16, nucl 8, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR020568  Ribosomal_S5_D2-typ_fold  
IPR014721  Ribosomal_S5_D2-typ_fold_subgr  
IPR000754  Ribosomal_S9  
IPR020574  Ribosomal_S9_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00380  Ribosomal_S9  
PROSITE View protein in PROSITE  
PS00360  RIBOSOMAL_S9  
Amino Acid Sequences MSAVQCFGKKKTATAVAHVTPGRGQVRLHGSPISVVEPSMLRYKIYEPILVVGPEKLANLDIRIRVKGGGQVSQLYAIRQAIAKGIVAFYAKNEDAASALELKKTLITYDRTLLVADPRRMEPKKFGGRGARARRQKSYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.49
3 0.42
4 0.47
5 0.45
6 0.38
7 0.29
8 0.33
9 0.28
10 0.23
11 0.22
12 0.22
13 0.3
14 0.3
15 0.31
16 0.26
17 0.25
18 0.24
19 0.25
20 0.2
21 0.13
22 0.11
23 0.1
24 0.1
25 0.11
26 0.15
27 0.14
28 0.13
29 0.14
30 0.16
31 0.21
32 0.22
33 0.21
34 0.17
35 0.18
36 0.19
37 0.18
38 0.17
39 0.11
40 0.1
41 0.09
42 0.09
43 0.07
44 0.06
45 0.06
46 0.07
47 0.09
48 0.12
49 0.13
50 0.13
51 0.14
52 0.13
53 0.13
54 0.15
55 0.14
56 0.14
57 0.13
58 0.13
59 0.13
60 0.15
61 0.14
62 0.11
63 0.11
64 0.08
65 0.08
66 0.08
67 0.08
68 0.07
69 0.07
70 0.07
71 0.06
72 0.06
73 0.07
74 0.07
75 0.06
76 0.06
77 0.1
78 0.1
79 0.1
80 0.1
81 0.1
82 0.1
83 0.1
84 0.11
85 0.1
86 0.1
87 0.1
88 0.1
89 0.11
90 0.11
91 0.11
92 0.11
93 0.12
94 0.16
95 0.18
96 0.21
97 0.22
98 0.21
99 0.21
100 0.21
101 0.25
102 0.29
103 0.29
104 0.29
105 0.31
106 0.4
107 0.42
108 0.45
109 0.44
110 0.47
111 0.54
112 0.54
113 0.57
114 0.58
115 0.65
116 0.72
117 0.75
118 0.75
119 0.74
120 0.78