Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1UD66

Protein Details
Accession A0A1Y1UD66    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
150-173SDSDNERERRKKKRRSMIGIESAIHydrophilic
NLS Segment(s)
PositionSequence
157-164ERRKKKRR
Subcellular Location(s) nucl 17, cyto_nucl 12, cyto 5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR014144  LigD_PE_domain  
Gene Ontology GO:0016874  F:ligase activity  
Pfam View protein in Pfam  
PF13298  LigD_N  
Amino Acid Sequences MWSIHKLNAKGKRTNEGYPDVPSSQDALQNLQTTFDEQWGFTAEDLERFPALRKRNFWCIQRHQARALHYDLRMQLDGATYSWAIPRGLLGMSKDGEVNRLAVETTLHPISYTTHEGADGRLLPSGERGGTLLWDIGTYTISYPWTGEGSDSDNERERRKKKRRSMIGIESAIHESNSDDPNGRHEEDKFRQAMRRKVRMGKSRSIHFTLSGGYKMTNHHYILVLSGGNTWAPTYSDGYPWGPGGEEGEEFGRSVKSLRRAKDGPEDLEHRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.61
3 0.58
4 0.53
5 0.49
6 0.5
7 0.41
8 0.37
9 0.31
10 0.28
11 0.24
12 0.25
13 0.21
14 0.2
15 0.23
16 0.25
17 0.24
18 0.23
19 0.22
20 0.21
21 0.21
22 0.21
23 0.18
24 0.15
25 0.16
26 0.17
27 0.17
28 0.14
29 0.16
30 0.13
31 0.15
32 0.15
33 0.16
34 0.14
35 0.14
36 0.17
37 0.21
38 0.28
39 0.32
40 0.38
41 0.42
42 0.52
43 0.58
44 0.61
45 0.64
46 0.66
47 0.71
48 0.73
49 0.71
50 0.67
51 0.64
52 0.62
53 0.55
54 0.51
55 0.45
56 0.37
57 0.37
58 0.32
59 0.32
60 0.28
61 0.24
62 0.2
63 0.16
64 0.16
65 0.12
66 0.12
67 0.08
68 0.08
69 0.09
70 0.1
71 0.09
72 0.08
73 0.08
74 0.08
75 0.08
76 0.09
77 0.09
78 0.1
79 0.11
80 0.11
81 0.12
82 0.11
83 0.12
84 0.11
85 0.11
86 0.08
87 0.08
88 0.08
89 0.07
90 0.08
91 0.07
92 0.09
93 0.09
94 0.09
95 0.09
96 0.09
97 0.11
98 0.13
99 0.15
100 0.13
101 0.13
102 0.13
103 0.13
104 0.13
105 0.13
106 0.1
107 0.08
108 0.08
109 0.08
110 0.08
111 0.08
112 0.09
113 0.07
114 0.06
115 0.06
116 0.05
117 0.06
118 0.06
119 0.05
120 0.04
121 0.04
122 0.04
123 0.04
124 0.04
125 0.04
126 0.04
127 0.05
128 0.05
129 0.05
130 0.05
131 0.06
132 0.06
133 0.06
134 0.06
135 0.06
136 0.09
137 0.1
138 0.11
139 0.12
140 0.17
141 0.19
142 0.24
143 0.32
144 0.36
145 0.46
146 0.56
147 0.65
148 0.7
149 0.78
150 0.84
151 0.84
152 0.86
153 0.84
154 0.81
155 0.73
156 0.63
157 0.54
158 0.45
159 0.36
160 0.26
161 0.18
162 0.1
163 0.12
164 0.12
165 0.11
166 0.11
167 0.11
168 0.16
169 0.2
170 0.21
171 0.19
172 0.2
173 0.29
174 0.31
175 0.37
176 0.35
177 0.34
178 0.4
179 0.45
180 0.52
181 0.53
182 0.58
183 0.59
184 0.65
185 0.72
186 0.75
187 0.74
188 0.74
189 0.7
190 0.68
191 0.67
192 0.62
193 0.54
194 0.45
195 0.39
196 0.33
197 0.29
198 0.23
199 0.18
200 0.15
201 0.15
202 0.17
203 0.21
204 0.23
205 0.21
206 0.22
207 0.22
208 0.22
209 0.21
210 0.2
211 0.15
212 0.1
213 0.1
214 0.09
215 0.08
216 0.08
217 0.07
218 0.07
219 0.08
220 0.09
221 0.13
222 0.13
223 0.15
224 0.18
225 0.19
226 0.2
227 0.19
228 0.17
229 0.14
230 0.13
231 0.14
232 0.12
233 0.11
234 0.11
235 0.12
236 0.12
237 0.12
238 0.13
239 0.11
240 0.1
241 0.13
242 0.18
243 0.26
244 0.33
245 0.38
246 0.46
247 0.48
248 0.54
249 0.62
250 0.62
251 0.57
252 0.57