Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1UIP4

Protein Details
Accession A0A1Y1UIP4    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
45-68LSKYNAKSARRRARPVHRDRRGGYBasic
NLS Segment(s)
PositionSequence
51-65KSARRRARPVHRDRR
104-105KG
Subcellular Location(s) nucl 17.5, cyto_nucl 11.5, cyto 4.5, mito 3
Family & Domain DBs
Amino Acid Sequences MICGYTVDLDRAATFTETFLAESFRPVISEINQRLSEDRSWAWVLSKYNAKSARRRARPVHRDRRGGYALMTQSVPGDNPKTKNDRSKYSKGREANSKGMQAPKGKRSGSDILKARCYNTSLNDIEDAWAMITIAEDPALHWADLSNDEPMDWPDEVIPWTGDDDLEHNPILHHTEPFLRMSGSWQLRSSLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.11
4 0.11
5 0.11
6 0.11
7 0.13
8 0.11
9 0.13
10 0.14
11 0.13
12 0.13
13 0.13
14 0.15
15 0.16
16 0.25
17 0.26
18 0.31
19 0.32
20 0.32
21 0.33
22 0.34
23 0.31
24 0.26
25 0.23
26 0.21
27 0.22
28 0.21
29 0.21
30 0.22
31 0.23
32 0.24
33 0.31
34 0.28
35 0.34
36 0.41
37 0.43
38 0.48
39 0.56
40 0.62
41 0.63
42 0.7
43 0.72
44 0.76
45 0.83
46 0.85
47 0.85
48 0.83
49 0.83
50 0.77
51 0.75
52 0.66
53 0.55
54 0.45
55 0.4
56 0.32
57 0.25
58 0.24
59 0.16
60 0.14
61 0.13
62 0.12
63 0.09
64 0.12
65 0.14
66 0.17
67 0.22
68 0.27
69 0.31
70 0.4
71 0.43
72 0.48
73 0.53
74 0.6
75 0.65
76 0.65
77 0.68
78 0.63
79 0.63
80 0.63
81 0.6
82 0.58
83 0.51
84 0.46
85 0.4
86 0.39
87 0.38
88 0.36
89 0.35
90 0.32
91 0.36
92 0.34
93 0.32
94 0.35
95 0.39
96 0.36
97 0.39
98 0.41
99 0.38
100 0.43
101 0.43
102 0.38
103 0.33
104 0.32
105 0.26
106 0.23
107 0.26
108 0.21
109 0.22
110 0.21
111 0.2
112 0.18
113 0.16
114 0.13
115 0.07
116 0.06
117 0.05
118 0.04
119 0.04
120 0.04
121 0.04
122 0.04
123 0.04
124 0.04
125 0.07
126 0.08
127 0.08
128 0.08
129 0.08
130 0.09
131 0.12
132 0.13
133 0.11
134 0.1
135 0.1
136 0.11
137 0.12
138 0.14
139 0.11
140 0.1
141 0.09
142 0.11
143 0.11
144 0.12
145 0.11
146 0.09
147 0.1
148 0.1
149 0.1
150 0.09
151 0.11
152 0.12
153 0.14
154 0.14
155 0.13
156 0.13
157 0.14
158 0.18
159 0.17
160 0.15
161 0.15
162 0.2
163 0.22
164 0.23
165 0.23
166 0.19
167 0.18
168 0.22
169 0.29
170 0.3
171 0.31
172 0.31