Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G9P6H9

Protein Details
Accession G9P6H9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
55-78DWLGCRVTEKRREKKKMCRGLEALHydrophilic
NLS Segment(s)
PositionSequence
17-31RKRNGTSRRLSKRAR
Subcellular Location(s) mito 25
Family & Domain DBs
Amino Acid Sequences MMGRYFVLTRRASGLWRKRNGTSRRLSKRARAPGLCCASCVRGCGCVCARGCCWDWLGCRVTEKRREKKKMCRGLEALRLQVGRSRMA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.48
3 0.54
4 0.56
5 0.59
6 0.67
7 0.69
8 0.68
9 0.68
10 0.69
11 0.71
12 0.76
13 0.73
14 0.72
15 0.75
16 0.76
17 0.74
18 0.67
19 0.61
20 0.61
21 0.64
22 0.55
23 0.46
24 0.38
25 0.32
26 0.29
27 0.27
28 0.18
29 0.17
30 0.17
31 0.19
32 0.18
33 0.21
34 0.21
35 0.22
36 0.22
37 0.21
38 0.23
39 0.2
40 0.21
41 0.19
42 0.2
43 0.22
44 0.24
45 0.21
46 0.24
47 0.28
48 0.34
49 0.41
50 0.5
51 0.56
52 0.65
53 0.75
54 0.79
55 0.85
56 0.88
57 0.89
58 0.84
59 0.82
60 0.78
61 0.75
62 0.76
63 0.69
64 0.6
65 0.54
66 0.49
67 0.41
68 0.38