Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1UJU7

Protein Details
Accession A0A1Y1UJU7   
Localization Confidence High
Confidence Score 22
NoLS Segment(s)
PositionSequenceProtein Nature
28-53VIPKTVKPSHKKGKKTEKKTFVKSVIHydrophilic
67-92MELLRNSKDKRARKFTKKKLGTLLRSHydrophilic
NLS Segment(s)
PositionSequence
33-47VKPSHKKGKKTEKKT
71-95RNSKDKRARKFTKKKLGTLLRSKRK
Subcellular Location(s) nucl 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR038097  L36e_sf  
IPR000509  Ribosomal_L36e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01158  Ribosomal_L36e  
PROSITE View protein in PROSITE  
PS01190  RIBOSOMAL_L36E  
Amino Acid Sequences MADVEMKSAPKERSNLRYGLNKGHPTTVIPKTVKPSHKKGKKTEKKTFVKSVIREVAGFAPYEKRIMELLRNSKDKRARKFTKKKLGTLLRSKRKVEELSAVIQEQRRQTGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.48
3 0.47
4 0.52
5 0.5
6 0.54
7 0.54
8 0.52
9 0.49
10 0.48
11 0.43
12 0.38
13 0.42
14 0.37
15 0.36
16 0.32
17 0.33
18 0.38
19 0.45
20 0.51
21 0.5
22 0.56
23 0.59
24 0.66
25 0.72
26 0.75
27 0.79
28 0.81
29 0.85
30 0.85
31 0.85
32 0.85
33 0.83
34 0.8
35 0.77
36 0.73
37 0.64
38 0.61
39 0.53
40 0.45
41 0.39
42 0.32
43 0.25
44 0.19
45 0.17
46 0.11
47 0.1
48 0.1
49 0.11
50 0.1
51 0.09
52 0.1
53 0.11
54 0.15
55 0.2
56 0.27
57 0.33
58 0.39
59 0.39
60 0.45
61 0.53
62 0.56
63 0.59
64 0.62
65 0.66
66 0.71
67 0.81
68 0.85
69 0.88
70 0.86
71 0.82
72 0.82
73 0.82
74 0.79
75 0.79
76 0.79
77 0.79
78 0.79
79 0.76
80 0.7
81 0.67
82 0.62
83 0.55
84 0.52
85 0.45
86 0.43
87 0.43
88 0.39
89 0.35
90 0.35
91 0.35
92 0.31