Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1USW1

Protein Details
Accession A0A1Y1USW1    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
310-334DPAFNASRAKRRRHRDGTMDRERGGBasic
NLS Segment(s)
PositionSequence
319-323KRRRH
Subcellular Location(s) nucl 12.5, cyto_nucl 9, mito 8, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013857  NADH-UbQ_OxRdtase-assoc_prot30  
IPR039131  NDUFAF1  
Pfam View protein in Pfam  
PF08547  CIA30  
Amino Acid Sequences MLTSLNFWETVSNGRSTIPPFTMYSFSSDLPPLEPPTIMALGADSDIGGLSTSNATSIPTAAFYDDPGPSSPLSFSSDQYENSVAVATGSHGGGISPGHIGSPSAGPSRPALKRDPNLPRITGSHMSHVALHGNMSLRLPPSQMGKIRTGYVGMRNHFRPTILGGEDAWDLRQYTHIKMQIAYRGWEGWRKRWYCNVQIAGPTGPSNIDVYQLRIELPPSSASTSSRAPLDPFSGVPPRWTTLHLPLSSFVLTNMGSTSPVQVGMDTEGVRSVGFSLLGGGRDNQGLPLGQPGQYLSQKHRDLSQVEDLDPAFNASRAKRRRHRDGTMDRERGGDGHPGGMDRVSITPFSEGYYELCVRYVQAVQYDPMTDDRPSEWDVWEEEQRLAKERQSPWE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.23
3 0.25
4 0.28
5 0.24
6 0.24
7 0.24
8 0.27
9 0.29
10 0.27
11 0.29
12 0.27
13 0.25
14 0.25
15 0.25
16 0.23
17 0.21
18 0.24
19 0.22
20 0.2
21 0.19
22 0.18
23 0.2
24 0.2
25 0.18
26 0.15
27 0.11
28 0.11
29 0.11
30 0.1
31 0.05
32 0.05
33 0.05
34 0.05
35 0.04
36 0.04
37 0.05
38 0.06
39 0.06
40 0.06
41 0.06
42 0.07
43 0.07
44 0.08
45 0.08
46 0.08
47 0.09
48 0.1
49 0.1
50 0.11
51 0.14
52 0.13
53 0.15
54 0.15
55 0.16
56 0.15
57 0.16
58 0.15
59 0.13
60 0.18
61 0.17
62 0.17
63 0.21
64 0.23
65 0.23
66 0.25
67 0.24
68 0.19
69 0.18
70 0.17
71 0.12
72 0.09
73 0.09
74 0.07
75 0.07
76 0.07
77 0.06
78 0.06
79 0.06
80 0.06
81 0.06
82 0.06
83 0.05
84 0.05
85 0.05
86 0.06
87 0.06
88 0.07
89 0.08
90 0.1
91 0.12
92 0.12
93 0.13
94 0.15
95 0.23
96 0.25
97 0.27
98 0.31
99 0.38
100 0.41
101 0.5
102 0.57
103 0.57
104 0.57
105 0.55
106 0.51
107 0.44
108 0.47
109 0.44
110 0.35
111 0.32
112 0.3
113 0.29
114 0.27
115 0.26
116 0.21
117 0.14
118 0.13
119 0.1
120 0.1
121 0.1
122 0.1
123 0.11
124 0.1
125 0.11
126 0.11
127 0.12
128 0.14
129 0.19
130 0.23
131 0.25
132 0.27
133 0.28
134 0.28
135 0.27
136 0.25
137 0.21
138 0.24
139 0.26
140 0.25
141 0.28
142 0.28
143 0.3
144 0.29
145 0.27
146 0.21
147 0.18
148 0.2
149 0.16
150 0.15
151 0.12
152 0.14
153 0.14
154 0.13
155 0.11
156 0.08
157 0.07
158 0.07
159 0.12
160 0.12
161 0.14
162 0.19
163 0.22
164 0.22
165 0.23
166 0.25
167 0.26
168 0.25
169 0.24
170 0.2
171 0.18
172 0.18
173 0.23
174 0.23
175 0.24
176 0.31
177 0.32
178 0.34
179 0.41
180 0.45
181 0.45
182 0.5
183 0.46
184 0.4
185 0.39
186 0.38
187 0.3
188 0.25
189 0.19
190 0.12
191 0.09
192 0.08
193 0.08
194 0.07
195 0.09
196 0.08
197 0.1
198 0.11
199 0.11
200 0.11
201 0.1
202 0.11
203 0.09
204 0.1
205 0.09
206 0.1
207 0.11
208 0.11
209 0.12
210 0.14
211 0.15
212 0.15
213 0.15
214 0.14
215 0.14
216 0.14
217 0.15
218 0.13
219 0.12
220 0.15
221 0.18
222 0.17
223 0.18
224 0.18
225 0.18
226 0.18
227 0.21
228 0.2
229 0.24
230 0.3
231 0.29
232 0.28
233 0.27
234 0.28
235 0.26
236 0.22
237 0.15
238 0.1
239 0.09
240 0.09
241 0.09
242 0.07
243 0.07
244 0.08
245 0.09
246 0.07
247 0.08
248 0.07
249 0.07
250 0.07
251 0.08
252 0.1
253 0.09
254 0.08
255 0.08
256 0.08
257 0.08
258 0.07
259 0.07
260 0.05
261 0.05
262 0.05
263 0.06
264 0.07
265 0.08
266 0.09
267 0.09
268 0.09
269 0.1
270 0.1
271 0.09
272 0.09
273 0.08
274 0.08
275 0.12
276 0.12
277 0.12
278 0.12
279 0.13
280 0.17
281 0.21
282 0.23
283 0.24
284 0.32
285 0.34
286 0.34
287 0.37
288 0.37
289 0.35
290 0.38
291 0.42
292 0.35
293 0.33
294 0.34
295 0.3
296 0.26
297 0.24
298 0.2
299 0.12
300 0.11
301 0.14
302 0.16
303 0.25
304 0.32
305 0.43
306 0.5
307 0.6
308 0.69
309 0.75
310 0.8
311 0.82
312 0.85
313 0.85
314 0.87
315 0.82
316 0.71
317 0.63
318 0.55
319 0.45
320 0.36
321 0.32
322 0.22
323 0.19
324 0.19
325 0.18
326 0.18
327 0.17
328 0.16
329 0.11
330 0.12
331 0.11
332 0.11
333 0.12
334 0.13
335 0.13
336 0.14
337 0.13
338 0.12
339 0.12
340 0.18
341 0.18
342 0.17
343 0.17
344 0.16
345 0.16
346 0.18
347 0.2
348 0.16
349 0.18
350 0.2
351 0.2
352 0.22
353 0.22
354 0.21
355 0.21
356 0.21
357 0.18
358 0.18
359 0.19
360 0.21
361 0.23
362 0.23
363 0.21
364 0.21
365 0.24
366 0.27
367 0.31
368 0.29
369 0.3
370 0.33
371 0.34
372 0.37
373 0.36
374 0.37
375 0.4