Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1UP80

Protein Details
Accession A0A1Y1UP80    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
6-29LYMKGRILGHKRGKRNSRPNQSLLHydrophilic
NLS Segment(s)
PositionSequence
15-20HKRGKR
Subcellular Location(s) mito 13.5, mito_nucl 13.333, nucl 12, cyto_nucl 7.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR038661  L35A_sf  
IPR001780  Ribosomal_L35A  
IPR009000  Transl_B-barrel_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01247  Ribosomal_L35Ae  
Amino Acid Sequences MGSSRLYMKGRILGHKRGKRNSRPNQSLLAIEGVDSKEAATHYLGKRVAYVYKAKREINGSRVRVIWGRISRPHGNSGVVKSKFRSNLPAKTFGASCRVMLYPSNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.63
3 0.69
4 0.73
5 0.79
6 0.8
7 0.85
8 0.86
9 0.86
10 0.85
11 0.8
12 0.75
13 0.66
14 0.56
15 0.47
16 0.37
17 0.26
18 0.19
19 0.17
20 0.12
21 0.1
22 0.09
23 0.07
24 0.07
25 0.07
26 0.08
27 0.07
28 0.13
29 0.14
30 0.19
31 0.2
32 0.19
33 0.2
34 0.2
35 0.2
36 0.17
37 0.24
38 0.23
39 0.3
40 0.34
41 0.33
42 0.34
43 0.38
44 0.39
45 0.39
46 0.43
47 0.38
48 0.36
49 0.36
50 0.35
51 0.32
52 0.3
53 0.29
54 0.24
55 0.26
56 0.29
57 0.35
58 0.38
59 0.39
60 0.41
61 0.36
62 0.36
63 0.34
64 0.36
65 0.38
66 0.36
67 0.35
68 0.34
69 0.38
70 0.39
71 0.39
72 0.43
73 0.41
74 0.48
75 0.51
76 0.57
77 0.51
78 0.5
79 0.49
80 0.41
81 0.4
82 0.32
83 0.27
84 0.23
85 0.22
86 0.21