FuNGI

A0A1Y1UJJ0

Protein Details

Accession

A0A1Y1UJJ0

Localization Confidence

Medium

Confidence Score

10.8

NoLS Segment(s)

Position	Sequence	Protein Nature
145-174	VELRQKKEITPTPRKKRFVRRKPLLERIAA	Hydrophilic

NLS Segment(s)

Position	Sequence
150-167	KKEITPTPRKKRFVRRKP

Subcellular Location(s)

mito 10, plas 8, nucl 7

Family & Domain DBs

InterPro	View protein in InterPro IPR018819 Nur1/Mug154
Gene Ontology	GO:0016020 C:membrane
Pfam	View protein in Pfam PF10332 DUF2418

Amino Acid Sequences

MKRSPSLRKSRRGLAPFAPTPSRLSHSTSAHELRNRHNLDDDEEADEDEVEKLKPQDEPRTDQGIQTGSFKFSQGSSAQQTTPGRFSTPIRNRSIGTGGLPASPRTPEIHYSPFATSTPPSGLSKSTSVPFDMAANDKAARRLDVELRQKKEITPTPRKKRFVRRKPLLERIAAYPQQLADMWLLNWPPSFENISPPAHYANPIALGTHVLHWLVLAPLLRREDEPQTVLRDTSVENRWSRFDDDESSQRSNLAGWKTFIFTLLLITLTSANSIYLFTRYRTYDMQLRSVSRALRAHSSTRLIFLQGRDAPVSPHASPVSTPHAPRRDSDINDLSSNNSSKVRSSLIGTIRAIKTIIVWAYTGILAIFGHHAAGLGNGFGAGQGGDTIQRLRVWEPPDFALHFFCAYPPSAPLLSYLLAPIHPFLTPFLHLITSFLLTHLAGSYSQFVKDRMVLSAEVMREYDQRFVYRKVFAPRVDRGVGTHDGPWYDL

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.72
2	0.71
3	0.65
4	0.64
5	0.58
6	0.5
7	0.47
8	0.45
9	0.42
10	0.35
11	0.37
12	0.38
13	0.38
14	0.41
15	0.46
16	0.47
17	0.49
18	0.52
19	0.5
20	0.5
21	0.57
22	0.55
23	0.5
24	0.5
25	0.46
26	0.44
27	0.46
28	0.4
29	0.33
30	0.3
31	0.29
32	0.23
33	0.21
34	0.17
35	0.13
36	0.12
37	0.09
38	0.12
39	0.13
40	0.14
41	0.2
42	0.25
43	0.35
44	0.39
45	0.46
46	0.49
47	0.56
48	0.54
49	0.5
50	0.48
51	0.41
52	0.36
53	0.34
54	0.29
55	0.24
56	0.24
57	0.23
58	0.2
59	0.17
60	0.2
61	0.17
62	0.21
63	0.24
64	0.27
65	0.26
66	0.32
67	0.35
68	0.34
69	0.35
70	0.31
71	0.27
72	0.26
73	0.3
74	0.35
75	0.41
76	0.46
77	0.48
78	0.5
79	0.49
80	0.5
81	0.49
82	0.39
83	0.31
84	0.27
85	0.22
86	0.23
87	0.23
88	0.2
89	0.18
90	0.18
91	0.18
92	0.17
93	0.19
94	0.2
95	0.24
96	0.28
97	0.28
98	0.3
99	0.3
100	0.29
101	0.26
102	0.25
103	0.2
104	0.18
105	0.18
106	0.18
107	0.18
108	0.18
109	0.19
110	0.2
111	0.21
112	0.21
113	0.22
114	0.2
115	0.2
116	0.19
117	0.18
118	0.16
119	0.16
120	0.16
121	0.14
122	0.15
123	0.16
124	0.16
125	0.19
126	0.18
127	0.18
128	0.17
129	0.19
130	0.23
131	0.3
132	0.4
133	0.45
134	0.48
135	0.5
136	0.49
137	0.47
138	0.5
139	0.49
140	0.48
141	0.51
142	0.58
143	0.66
144	0.75
145	0.8
146	0.81
147	0.85
148	0.86
149	0.86
150	0.87
151	0.86
152	0.87
153	0.89
154	0.9
155	0.84
156	0.75
157	0.66
158	0.59
159	0.56
160	0.46
161	0.38
162	0.28
163	0.23
164	0.21
165	0.19
166	0.16
167	0.09
168	0.09
169	0.08
170	0.09
171	0.1
172	0.09
173	0.09
174	0.09
175	0.09
176	0.1
177	0.13
178	0.11
179	0.16
180	0.19
181	0.2
182	0.2
183	0.21
184	0.2
185	0.17
186	0.18
187	0.14
188	0.12
189	0.12
190	0.11
191	0.1
192	0.08
193	0.09
194	0.09
195	0.09
196	0.09
197	0.07
198	0.07
199	0.06
200	0.07
201	0.05
202	0.06
203	0.06
204	0.06
205	0.09
206	0.1
207	0.11
208	0.11
209	0.14
210	0.16
211	0.16
212	0.18
213	0.17
214	0.19
215	0.19
216	0.18
217	0.16
218	0.13
219	0.13
220	0.16
221	0.18
222	0.2
223	0.2
224	0.22
225	0.23
226	0.24
227	0.25
228	0.21
229	0.19
230	0.18
231	0.2
232	0.23
233	0.26
234	0.25
235	0.23
236	0.22
237	0.21
238	0.18
239	0.19
240	0.17
241	0.14
242	0.14
243	0.15
244	0.15
245	0.15
246	0.15
247	0.11
248	0.09
249	0.08
250	0.07
251	0.06
252	0.05
253	0.06
254	0.06
255	0.05
256	0.05
257	0.05
258	0.04
259	0.04
260	0.05
261	0.05
262	0.08
263	0.09
264	0.09
265	0.13
266	0.14
267	0.17
268	0.18
269	0.2
270	0.24
271	0.25
272	0.29
273	0.28
274	0.28
275	0.28
276	0.29
277	0.27
278	0.25
279	0.25
280	0.22
281	0.24
282	0.25
283	0.26
284	0.26
285	0.29
286	0.25
287	0.25
288	0.24
289	0.21
290	0.21
291	0.18
292	0.22
293	0.2
294	0.21
295	0.2
296	0.2
297	0.19
298	0.19
299	0.22
300	0.16
301	0.17
302	0.16
303	0.15
304	0.16
305	0.18
306	0.22
307	0.21
308	0.23
309	0.28
310	0.34
311	0.35
312	0.36
313	0.41
314	0.41
315	0.41
316	0.46
317	0.43
318	0.39
319	0.39
320	0.39
321	0.32
322	0.28
323	0.27
324	0.21
325	0.19
326	0.17
327	0.17
328	0.18
329	0.19
330	0.17
331	0.18
332	0.23
333	0.24
334	0.28
335	0.28
336	0.32
337	0.3
338	0.3
339	0.27
340	0.2
341	0.18
342	0.16
343	0.16
344	0.1
345	0.1
346	0.09
347	0.1
348	0.1
349	0.1
350	0.06
351	0.06
352	0.05
353	0.05
354	0.06
355	0.05
356	0.05
357	0.05
358	0.05
359	0.05
360	0.06
361	0.05
362	0.04
363	0.04
364	0.04
365	0.04
366	0.04
367	0.04
368	0.03
369	0.03
370	0.03
371	0.04
372	0.05
373	0.06
374	0.07
375	0.08
376	0.09
377	0.11
378	0.13
379	0.18
380	0.21
381	0.24
382	0.26
383	0.26
384	0.29
385	0.29
386	0.28
387	0.25
388	0.22
389	0.2
390	0.17
391	0.16
392	0.14
393	0.14
394	0.14
395	0.13
396	0.16
397	0.15
398	0.15
399	0.16
400	0.17
401	0.16
402	0.15
403	0.15
404	0.12
405	0.12
406	0.12
407	0.11
408	0.1
409	0.09
410	0.1
411	0.11
412	0.13
413	0.14
414	0.14
415	0.15
416	0.15
417	0.15
418	0.16
419	0.16
420	0.15
421	0.13
422	0.13
423	0.13
424	0.11
425	0.12
426	0.11
427	0.1
428	0.08
429	0.1
430	0.14
431	0.14
432	0.16
433	0.18
434	0.18
435	0.2
436	0.23
437	0.23
438	0.21
439	0.23
440	0.21
441	0.21
442	0.25
443	0.23
444	0.2
445	0.19
446	0.19
447	0.21
448	0.22
449	0.25
450	0.23
451	0.28
452	0.31
453	0.36
454	0.39
455	0.4
456	0.45
457	0.48
458	0.53
459	0.54
460	0.57
461	0.58
462	0.6
463	0.57
464	0.51
465	0.44
466	0.42
467	0.4
468	0.35
469	0.31
470	0.27

A0A1Y1UJJ0

3D AlphaFold-predicted Structure Viewer