Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1UK14

Protein Details
Accession A0A1Y1UK14   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
107-132GDGGGKSRSKSKSKSKKKDTDEGADGBasic
NLS Segment(s)
PositionSequence
110-124GGKSRSKSKSKSKKK
Subcellular Location(s) cyto 13, mito 7, cyto_nucl 7
Family & Domain DBs
Amino Acid Sequences MNSSAFAYALDPAVSQAQAYSAAMGHNVIVHYPDLPKFGEYQGGKGSWSSARRGTDGWTGYGWEGEGTKLPDKDGLTFGAPMPKGQELSKAGSVSGGGAGALPSGGGDGGGKSRSKSKSKSKKKDTDEGADGEGGGGGNDAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.08
4 0.08
5 0.09
6 0.09
7 0.08
8 0.07
9 0.07
10 0.07
11 0.08
12 0.07
13 0.07
14 0.07
15 0.07
16 0.07
17 0.07
18 0.08
19 0.1
20 0.11
21 0.12
22 0.12
23 0.13
24 0.13
25 0.14
26 0.2
27 0.18
28 0.2
29 0.21
30 0.2
31 0.2
32 0.18
33 0.2
34 0.17
35 0.18
36 0.19
37 0.21
38 0.22
39 0.23
40 0.23
41 0.24
42 0.25
43 0.24
44 0.22
45 0.18
46 0.17
47 0.16
48 0.15
49 0.12
50 0.07
51 0.06
52 0.05
53 0.07
54 0.08
55 0.1
56 0.1
57 0.1
58 0.13
59 0.13
60 0.14
61 0.14
62 0.13
63 0.11
64 0.12
65 0.12
66 0.14
67 0.13
68 0.12
69 0.13
70 0.12
71 0.13
72 0.12
73 0.17
74 0.15
75 0.19
76 0.21
77 0.2
78 0.19
79 0.17
80 0.17
81 0.12
82 0.1
83 0.06
84 0.04
85 0.04
86 0.04
87 0.03
88 0.03
89 0.03
90 0.02
91 0.02
92 0.02
93 0.02
94 0.03
95 0.03
96 0.06
97 0.08
98 0.09
99 0.1
100 0.18
101 0.25
102 0.32
103 0.4
104 0.5
105 0.59
106 0.7
107 0.8
108 0.84
109 0.87
110 0.87
111 0.89
112 0.85
113 0.83
114 0.76
115 0.67
116 0.58
117 0.48
118 0.4
119 0.3
120 0.23
121 0.14
122 0.09