Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1UT48

Protein Details
Accession A0A1Y1UT48    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
15-47RSQAPKVEKQEKKKTPKGRAKKRAQYNRRFVNVHydrophilic
NLS Segment(s)
PositionSequence
11-39AGKVRSQAPKVEKQEKKKTPKGRAKKRAQ
Subcellular Location(s) nucl 10, mito 10, mito_nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVRSQAPKVEKQEKKKTPKGRAKKRAQYNRRFVNVTLTPGGKRKVNPQPAGKSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.38
3 0.39
4 0.42
5 0.45
6 0.54
7 0.58
8 0.63
9 0.64
10 0.67
11 0.73
12 0.76
13 0.79
14 0.78
15 0.8
16 0.8
17 0.84
18 0.85
19 0.86
20 0.87
21 0.88
22 0.88
23 0.89
24 0.9
25 0.89
26 0.88
27 0.87
28 0.85
29 0.79
30 0.72
31 0.62
32 0.59
33 0.51
34 0.45
35 0.39
36 0.32
37 0.29
38 0.31
39 0.34
40 0.3
41 0.29
42 0.35
43 0.42
44 0.51
45 0.57
46 0.62