Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9NFG4

Protein Details
Accession G9NFG4    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
438-483ETPAGDEDKKKRKKHDGETAEEKAERKRRKAEKKAAKAAKKGGKDDBasic
NLS Segment(s)
PositionSequence
446-481KKKRKKHDGETAEEKAERKRRKAEKKAAKAAKKGGK
Subcellular Location(s) cyto 15.5, cyto_nucl 12.5, nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012960  Dyskerin-like  
IPR020103  PsdUridine_synth_cat_dom_sf  
IPR002501  PsdUridine_synth_N  
IPR002478  PUA  
IPR015947  PUA-like_sf  
IPR036974  PUA_sf  
IPR004802  tRNA_PsdUridine_synth_B_fam  
IPR032819  TruB_C  
IPR004521  Uncharacterised_CHP00451  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0009982  F:pseudouridine synthase activity  
GO:0003723  F:RNA binding  
GO:0001522  P:pseudouridine synthesis  
GO:0042254  P:ribosome biogenesis  
GO:0006396  P:RNA processing  
Pfam View protein in Pfam  
PF08068  DKCLD  
PF01472  PUA  
PF16198  TruB_C_2  
PF01509  TruB_N  
PROSITE View protein in PROSITE  
PS50890  PUA  
CDD cd02572  PseudoU_synth_hDyskerin  
cd21148  PUA_Cbf5  
Amino Acid Sequences MVTEVVNKKKEQEQEHIIKPQATTPAVDTSEWPLLLKNYDNLLVRTGHFTPIPNGSAPLKRDIKSYISSGVINLDKPSNPSSHEVVSWVKRILRVEKTGHSGTLDPKVTGCLIVCIDRATRLVKSQQGAGKEYVAIIRLHDKLPGGQAQFARALETLTGALFQRPPLISAVKRQLRIRTIHESKLIEFDNDRHLGVFWVSCEAGTYIRTLCVHLGLLLGVGAHMQELRRVRSGAMDETKHLVTLHDVLDAQWTMDNTRDESYLRRVIAPLETLLTGYKRLVVKDSAVNAVCYGAKLMLPGLLRYESGIEHHEEVVLMTTKGEAIAIGIAQMSTVEMSTCDHGVVAKVKRCIMERDLYPRRWGLGPVAQEKKKLKADGKLDKFGRPNDATPAKWTSDYKDFSVSDASAAAAAAAPATTSIPVLPSTPSKEADTKMDDAETPAGDEDKKKRKKHDGETAEEKAERKRRKAEKKAAKAAKKGGKDDEDSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.66
3 0.68
4 0.65
5 0.59
6 0.54
7 0.49
8 0.45
9 0.38
10 0.32
11 0.28
12 0.31
13 0.3
14 0.3
15 0.27
16 0.26
17 0.29
18 0.27
19 0.25
20 0.2
21 0.2
22 0.23
23 0.23
24 0.21
25 0.2
26 0.25
27 0.27
28 0.26
29 0.27
30 0.26
31 0.25
32 0.27
33 0.26
34 0.24
35 0.23
36 0.24
37 0.25
38 0.27
39 0.28
40 0.24
41 0.25
42 0.27
43 0.31
44 0.31
45 0.37
46 0.38
47 0.37
48 0.39
49 0.4
50 0.4
51 0.38
52 0.39
53 0.34
54 0.29
55 0.29
56 0.26
57 0.28
58 0.24
59 0.22
60 0.21
61 0.2
62 0.19
63 0.22
64 0.24
65 0.21
66 0.22
67 0.26
68 0.27
69 0.26
70 0.26
71 0.25
72 0.29
73 0.31
74 0.31
75 0.3
76 0.28
77 0.3
78 0.34
79 0.38
80 0.38
81 0.4
82 0.42
83 0.44
84 0.48
85 0.46
86 0.43
87 0.37
88 0.33
89 0.3
90 0.33
91 0.3
92 0.23
93 0.22
94 0.23
95 0.22
96 0.2
97 0.17
98 0.11
99 0.11
100 0.13
101 0.13
102 0.13
103 0.13
104 0.13
105 0.15
106 0.15
107 0.15
108 0.17
109 0.22
110 0.25
111 0.26
112 0.3
113 0.31
114 0.32
115 0.34
116 0.32
117 0.28
118 0.23
119 0.22
120 0.17
121 0.16
122 0.13
123 0.11
124 0.15
125 0.16
126 0.16
127 0.17
128 0.16
129 0.16
130 0.19
131 0.22
132 0.19
133 0.21
134 0.21
135 0.21
136 0.23
137 0.22
138 0.2
139 0.15
140 0.15
141 0.11
142 0.11
143 0.09
144 0.07
145 0.08
146 0.06
147 0.08
148 0.08
149 0.08
150 0.11
151 0.11
152 0.12
153 0.14
154 0.17
155 0.17
156 0.23
157 0.33
158 0.34
159 0.38
160 0.4
161 0.43
162 0.44
163 0.47
164 0.47
165 0.47
166 0.47
167 0.46
168 0.48
169 0.44
170 0.39
171 0.4
172 0.34
173 0.25
174 0.21
175 0.2
176 0.2
177 0.2
178 0.19
179 0.15
180 0.15
181 0.14
182 0.14
183 0.12
184 0.07
185 0.08
186 0.07
187 0.07
188 0.07
189 0.07
190 0.07
191 0.07
192 0.08
193 0.07
194 0.08
195 0.09
196 0.09
197 0.09
198 0.09
199 0.08
200 0.07
201 0.07
202 0.05
203 0.05
204 0.04
205 0.04
206 0.03
207 0.03
208 0.02
209 0.02
210 0.03
211 0.03
212 0.07
213 0.09
214 0.11
215 0.13
216 0.13
217 0.14
218 0.16
219 0.18
220 0.19
221 0.21
222 0.2
223 0.19
224 0.21
225 0.21
226 0.18
227 0.17
228 0.12
229 0.09
230 0.11
231 0.1
232 0.08
233 0.08
234 0.08
235 0.09
236 0.09
237 0.08
238 0.07
239 0.06
240 0.06
241 0.09
242 0.09
243 0.1
244 0.1
245 0.11
246 0.11
247 0.13
248 0.18
249 0.19
250 0.19
251 0.18
252 0.17
253 0.18
254 0.18
255 0.17
256 0.12
257 0.09
258 0.09
259 0.08
260 0.09
261 0.08
262 0.08
263 0.07
264 0.11
265 0.11
266 0.11
267 0.14
268 0.14
269 0.16
270 0.18
271 0.2
272 0.2
273 0.19
274 0.18
275 0.16
276 0.16
277 0.14
278 0.1
279 0.09
280 0.06
281 0.05
282 0.05
283 0.06
284 0.08
285 0.08
286 0.08
287 0.09
288 0.09
289 0.09
290 0.1
291 0.1
292 0.08
293 0.09
294 0.1
295 0.1
296 0.11
297 0.11
298 0.11
299 0.1
300 0.1
301 0.11
302 0.1
303 0.08
304 0.07
305 0.07
306 0.07
307 0.07
308 0.06
309 0.04
310 0.03
311 0.04
312 0.03
313 0.04
314 0.04
315 0.03
316 0.03
317 0.03
318 0.03
319 0.03
320 0.03
321 0.03
322 0.03
323 0.05
324 0.06
325 0.06
326 0.06
327 0.06
328 0.07
329 0.09
330 0.15
331 0.2
332 0.23
333 0.25
334 0.27
335 0.3
336 0.32
337 0.35
338 0.33
339 0.34
340 0.33
341 0.41
342 0.47
343 0.47
344 0.47
345 0.43
346 0.42
347 0.36
348 0.34
349 0.28
350 0.25
351 0.29
352 0.35
353 0.42
354 0.41
355 0.47
356 0.48
357 0.51
358 0.52
359 0.53
360 0.49
361 0.49
362 0.57
363 0.61
364 0.65
365 0.67
366 0.63
367 0.62
368 0.62
369 0.57
370 0.55
371 0.47
372 0.42
373 0.42
374 0.45
375 0.41
376 0.4
377 0.42
378 0.36
379 0.36
380 0.36
381 0.32
382 0.35
383 0.38
384 0.35
385 0.37
386 0.35
387 0.33
388 0.35
389 0.29
390 0.21
391 0.19
392 0.17
393 0.1
394 0.1
395 0.08
396 0.05
397 0.05
398 0.04
399 0.04
400 0.03
401 0.04
402 0.04
403 0.05
404 0.05
405 0.05
406 0.06
407 0.07
408 0.09
409 0.11
410 0.15
411 0.2
412 0.23
413 0.26
414 0.28
415 0.32
416 0.34
417 0.37
418 0.38
419 0.35
420 0.33
421 0.32
422 0.28
423 0.26
424 0.26
425 0.2
426 0.16
427 0.15
428 0.15
429 0.15
430 0.21
431 0.28
432 0.37
433 0.46
434 0.52
435 0.61
436 0.71
437 0.8
438 0.84
439 0.86
440 0.84
441 0.84
442 0.86
443 0.81
444 0.74
445 0.67
446 0.58
447 0.56
448 0.57
449 0.56
450 0.55
451 0.6
452 0.67
453 0.75
454 0.85
455 0.87
456 0.88
457 0.91
458 0.94
459 0.94
460 0.92
461 0.88
462 0.87
463 0.85
464 0.81
465 0.76
466 0.73
467 0.69