Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1URB1

Protein Details
Accession A0A1Y1URB1   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
71-97DKYTTFSHKGRKFRKGQHHVPKWTRLTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23.5, cyto_mito 12.833, cyto_nucl 1.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MLGAFRSSQVALGGLLWKRSWRMSTTQKQGQRDRLRRVDNVIACVAESNVKFRALDKALALPTEHEMLPKDKYTTFSHKGRKFRKGQHHVPKWTRLTMRTNPKGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.15
4 0.16
5 0.17
6 0.2
7 0.22
8 0.2
9 0.27
10 0.36
11 0.45
12 0.53
13 0.59
14 0.62
15 0.67
16 0.71
17 0.73
18 0.73
19 0.72
20 0.72
21 0.72
22 0.71
23 0.65
24 0.63
25 0.6
26 0.51
27 0.45
28 0.37
29 0.28
30 0.23
31 0.21
32 0.16
33 0.12
34 0.1
35 0.1
36 0.1
37 0.11
38 0.11
39 0.11
40 0.16
41 0.15
42 0.16
43 0.14
44 0.16
45 0.16
46 0.17
47 0.16
48 0.12
49 0.11
50 0.12
51 0.12
52 0.09
53 0.11
54 0.12
55 0.15
56 0.16
57 0.16
58 0.15
59 0.2
60 0.25
61 0.32
62 0.36
63 0.42
64 0.51
65 0.56
66 0.65
67 0.69
68 0.73
69 0.74
70 0.77
71 0.81
72 0.8
73 0.84
74 0.85
75 0.87
76 0.88
77 0.86
78 0.85
79 0.79
80 0.77
81 0.71
82 0.65
83 0.64
84 0.63
85 0.67