Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1UBK0

Protein Details
Accession A0A1Y1UBK0    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
174-202IEEPKRKGVKSREKWKRLRKLVAERFPGRBasic
NLS Segment(s)
PositionSequence
177-222PKRKGVKSREKWKRLRKLVAERFPGRGPLGQSRHALRRAGRRLREA
Subcellular Location(s) nucl 11, cyto_nucl 11, cyto 9, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036389  RNase_III_sf  
Gene Ontology GO:0004525  F:ribonuclease III activity  
GO:0006396  P:RNA processing  
Amino Acid Sequences METPSGWTPLVLRFNDSALPTLPWLAETAKYSLHPCGGETLKHLAWNGDSVLKGAATRALVRYPINRNRSGVDKNWISMFRGRVLSNNVFSYLALSYDLVNEETAATIAQKRAADLFGAYVGASDLKRESHQSHGMTEFLRELFSEAVWPDLQLRFPEQDDGSQCSPATSDGEIEEPKRKGVKSREKWKRLRKLVAERFPGRGPLGQSRHALRRAGRRLREAGYWKH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.31
3 0.3
4 0.25
5 0.2
6 0.2
7 0.17
8 0.18
9 0.16
10 0.13
11 0.13
12 0.13
13 0.14
14 0.14
15 0.15
16 0.16
17 0.18
18 0.19
19 0.2
20 0.21
21 0.19
22 0.18
23 0.22
24 0.23
25 0.22
26 0.23
27 0.26
28 0.24
29 0.25
30 0.25
31 0.2
32 0.18
33 0.19
34 0.17
35 0.14
36 0.13
37 0.12
38 0.12
39 0.11
40 0.11
41 0.09
42 0.1
43 0.09
44 0.1
45 0.11
46 0.12
47 0.14
48 0.16
49 0.22
50 0.29
51 0.36
52 0.41
53 0.42
54 0.42
55 0.42
56 0.47
57 0.45
58 0.39
59 0.38
60 0.33
61 0.32
62 0.34
63 0.32
64 0.28
65 0.28
66 0.26
67 0.22
68 0.24
69 0.23
70 0.22
71 0.27
72 0.28
73 0.26
74 0.25
75 0.23
76 0.2
77 0.19
78 0.18
79 0.12
80 0.09
81 0.07
82 0.07
83 0.06
84 0.06
85 0.07
86 0.06
87 0.06
88 0.06
89 0.05
90 0.05
91 0.05
92 0.04
93 0.04
94 0.05
95 0.05
96 0.08
97 0.08
98 0.08
99 0.09
100 0.09
101 0.09
102 0.08
103 0.08
104 0.05
105 0.05
106 0.05
107 0.04
108 0.04
109 0.05
110 0.04
111 0.05
112 0.05
113 0.06
114 0.07
115 0.1
116 0.12
117 0.17
118 0.22
119 0.23
120 0.25
121 0.25
122 0.25
123 0.22
124 0.21
125 0.17
126 0.11
127 0.1
128 0.08
129 0.08
130 0.07
131 0.07
132 0.08
133 0.07
134 0.08
135 0.08
136 0.08
137 0.09
138 0.1
139 0.11
140 0.11
141 0.13
142 0.13
143 0.14
144 0.17
145 0.16
146 0.19
147 0.2
148 0.25
149 0.23
150 0.23
151 0.22
152 0.19
153 0.18
154 0.16
155 0.15
156 0.1
157 0.1
158 0.09
159 0.12
160 0.14
161 0.16
162 0.22
163 0.2
164 0.23
165 0.27
166 0.27
167 0.32
168 0.42
169 0.51
170 0.55
171 0.66
172 0.73
173 0.8
174 0.89
175 0.91
176 0.92
177 0.9
178 0.9
179 0.88
180 0.89
181 0.89
182 0.88
183 0.87
184 0.78
185 0.73
186 0.64
187 0.58
188 0.48
189 0.41
190 0.37
191 0.37
192 0.39
193 0.4
194 0.43
195 0.46
196 0.51
197 0.52
198 0.52
199 0.49
200 0.55
201 0.61
202 0.66
203 0.67
204 0.66
205 0.68
206 0.66
207 0.68