Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1U6R4

Protein Details
Accession A0A1Y1U6R4   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
2-21FGSHKRSHTHTSHRQNRIRGBasic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto_nucl 11.5, mito 5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR018824  Conidiation-specific_6  
Pfam View protein in Pfam  
PF10346  Con-6  
Amino Acid Sequences MFGSHKRSHTHTSHRQNRIRGLRSAINNPRTTHAGRTEAKAELHAMGATANKPSFGTRVRHLFGLPGKSHHRNKHHRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.8
3 0.78
4 0.8
5 0.79
6 0.73
7 0.65
8 0.61
9 0.57
10 0.54
11 0.58
12 0.56
13 0.53
14 0.52
15 0.49
16 0.47
17 0.44
18 0.41
19 0.36
20 0.31
21 0.31
22 0.29
23 0.3
24 0.29
25 0.27
26 0.25
27 0.22
28 0.19
29 0.13
30 0.12
31 0.09
32 0.07
33 0.06
34 0.07
35 0.07
36 0.08
37 0.08
38 0.08
39 0.09
40 0.09
41 0.13
42 0.16
43 0.2
44 0.24
45 0.31
46 0.33
47 0.33
48 0.33
49 0.35
50 0.35
51 0.39
52 0.35
53 0.33
54 0.39
55 0.48
56 0.56
57 0.6
58 0.66